TrypDB Analysis Workflow Common Analysis T Cruzi Analysis T Brucei Analysis L Braziliensis Analysis L Infantum Analysis L Major Analysis Mercator.

Slides:



Advertisements
Similar presentations
Business logic for annotation workflow Tom Oldfield July 21, 2010.
Advertisements

Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.
Homology Based Analysis of the Human/Mouse lncRNome
Building CryptoDB using GUS Mark Heiges Center for Tropical and Emerging Global Diseases University of Georgia
January 25, Current and Future Database (CH)  Indexing vgd_common (JM; 1Q)  Fully implement Taxonomy tables (JO, DD; 2Q)  Allow subspecies-level.
UCSC Genome Browser Tutorial
Genome Browsing with the UCSC Genome Browser
Model of a real workflow
A Tool for Supporting Integration Across Multiple Flat-File Datasets Xuan Zhang, Gagan Agrawal Ohio State University.
Working with the Conifer_dbMagic database: A short tutorial on mining conifer assembly data. This tutorial is designed to be used in a “follow along” fashion.
GUS Overview June 18, GUS-3.0 Supports application and data integration Uses an extensible architecture. Is object-oriented even though it uses.
Input for the Bayesian Phylogenetic Workflow All Input values could be loaded as text file or typing directly. Only for the multifasta file is advised.
Viewing & Getting GO COST Functional Modeling Workshop April, Helsinki.
Basic Introduction of BLAST Jundi Wang School of Computing CSC691 09/08/2013.
How I learned to quit worrying Deanna M. Church Staff Scientist, Short Course in Medical Genetics 2013 And love multiple coordinate.
NCBI Review Concepts Chuong Huynh. NCBI Pairwise Sequence Alignments Purpose: identification of sequences with significant similarity to (a)
SAGExplore web server tutorial for Module II: Genome Mapping.
Blast 1. Blast 2 Low Complexity masking >GDB1_WHEAT MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQ QPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQI.
CSIU Submission of BLAST jobs via the Galaxy Interface Rob Quick Open Science Grid – Operations Area Coordinator Indiana University.
Module 3 Sequence and Protein Analysis (Using web-based tools) Working with Pathogen Genomes - Uruguay 2008.
UMR ASP UMR ASP Structural & Comparative Genomics in Bread Wheat TriAnnotPipeline A LifeGrid Project based on AUVERGRID F. Giacomoni, M.
CISC667, F05, Lec9, Liao CISC 667 Intro to Bioinformatics (Fall 2005) Sequence Database search Heuristic algorithms –FASTA –BLAST –PSI-BLAST.
Browsing the Genome Using Genome Browsers to Visualize and Mine Data.
1 LSM2241 AY0910 Semester 2 MiniProject Briefing Round 5.
Assignment feedback Everyone is doing very well!
SAGExplore web server tutorial for Module I: Genome Explore.
GMOD/GBrowse_syn Sheldon McKay Reactome Ontario Institute for Cancer Research.
Building WormBase database(s). SAB 2008 Wellcome Trust Sanger Insitute Cold Spring Harbor Laboratory California Institute of Technology ● RNAi ● Microarray.
A Genomics View of Unix. General Unix Tips To use the command line start X11 and type commands into the “xterm” window A few things about unix commands:
NCBI Genome Workbench Chuong Huynh NIH/NLM/NCBI Sao Paulo, Brasil July 15, 2004 Slides from Michael Dicuccio’s Genome Workbench.
Legend Global = Subgraph call Make Data Dir = Step Load Genomic Sequence & Annotation = Subgraph reference Proteome Analysis = Optional step [Taxon] Pk.
Having a Blast! on DiaGrid Carol Song Rosen Center for Advanced Computing December 9, 2011.
Orthology & Paralogy Alignment & Assembly Alastair Kerr Ph.D. WTCCB Bioinformatics Core [many slides borrowed from various sources]
EBI is an Outstation of the European Molecular Biology Laboratory. EBI patent related services Jennifer McDowall Senior Scientist, EMBL-EBI 3 rd Annual.
Pipeline Introduction Sequential steps of –Plugin calls –Script calls –Cluster jobs Purpose –Codifies the process of creating the data set –Reduces human.
Worldwide Protein Data Bank Common D&A Project Sequence Processing Modular Demo May 6, 2010 Project Deliverable.
SAGExplore web server tutorial. The SAGExplore server has three different modules …
David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.
SRB Genome Assembly and Analysis From 454 Sequences HC70AL S Brandon Le & Min Chen.
TrypDB Analysis Workflow Common Analysis T Cruzi Analysis T Brucei Analysis L Braziliensis Analysis L Infantum Analysis L Major Analysis Mercator.
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
Copyright OpenHelix. No use or reproduction without express written consent1.
454 Genome Sequence Assembly and Analysis HC70AL S Brandon Le & Min Chen.
Legend Global = Subgraph call Make Data Dir = Step Load Genomic Sequence & Annotation = Subgraph reference Proteome Analysis = Optional step [Taxon] Pk.
The Genome Genome Browser Training Materials developed by: Warren C. Lathe, Ph.D. and Mary Mangan, Ph.D. Part 2.
Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.
Model of a real workflow A subset of the plasmodb pipeline (in progress!) And issues to discuss…
PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.
Bioinformatics Shared Resource Bioinformatics : How to… Bioinformatics Shared Resource Kutbuddin Doctor, PhD.
Designing, Executing and Sharing Workflows with Taverna 2.4 Different Service Types Katy Wolstencroft Helen Hulme myGrid University of Manchester.
What is BLAST? Basic BLAST search What is BLAST?
Dhanvantari GenOME to hit
Annotating The data.
Computing challenges in working with genomics-scale data
A Practical Guide to NCBI BLAST
VCF format: variants c.f. S. Brown NYU
NCBI Molecular Biology Resources
Basics of BLAST Basic BLAST Search - What is BLAST?
Genome Sequence Annotation Server
Genome Sequence Annotation Server
GEP Annotation Workflow
Bioinformatics Research Group
This tutorial is designed to be used in a “follow along” fashion
INFORMATION FLOW AARTHI & NEHA.
BLAST.
Practice Clone 3 Download and get ready!.
A web-based platform for structural and functional annotation of model and non-model organisms Jodi Humann, Taein Lee, Stephen Ficklin,
Multiple sequence alignment & Phylogenetics Analysis
Follow-up from last night: XSEDE credits
Welcome - webinar instructions
Presentation transcript:

TrypDB Analysis Workflow Common Analysis T Cruzi Analysis T Brucei Analysis L Braziliensis Analysis L Infantum Analysis L Major Analysis Mercator

Common Analysis Init Workflow Home Dir on Cluster Init User/Group/Project Copy PDB from Downloads Make Data Dir Mirror Common Data Dir to Cluster Copy NRDB from Downloads Make NRDB Short Defline Make Mercator Data Dir Init apiSiteFiles WebServices Dirs Insert BlatAlignmentQuality Table with Xml

Organism Analysis Workflow Genome Analysis Proteome Analysis Mirror Data Dir to Cluster Make Gff File Run Full Record Dump Init apiSiteFiles DownloadSite Organism Dir Make Data Dir Make and Format Download Files Run Tuning Manager

Genome Analysis Extract Genome Seqs Find Tandem Repeats Load Tandem Repeats Copy Genomic Seqs to Cluster BLASTX NRDB Filter Sequences Load Low Complexity Seqs Make Data Dir Dump and Block Mixed Genome Seqs tRNA Scan Load ORFs Make ORFs Make and Block Candidate Assem Seqs Make and Block DoTS Assemblies Map Candidate Assem Seqs to Genome Map DoTS Assemblies to genome

Proteome Analysis Calcuate Protein Seq Calculate AASeq Attributes Extract Protein Seqs Filter Seqs Load Low Complexity Seqs Copy Protein Seqs to Cluster BLASTP NRDB PsipredInterproScan Run TMHMM Load TMHMM Run SignalP Load SignalP Epitopes Find Seq Identity to NRDB Load NRDB xrefs BLASTP PDB Make Data Dir Update TaxonId for PDB ExternalAASequence

BLAST Make data dir Start blast Wait for cluster Copy files From cluster extract IDs From Blast result Load Subject subset Load Result Optional steps (runtime test) filter by subject Update TaxonId for Nrdb ExternalAASequence

Psipred fix protein IDs For psipred create psipred Task dir copy Data Dir to cluster start psipred On cluster wait for cluster copy psipred Files from cluster fix psipred File names make Alg Inv load psipred run pfilt on nrdb Make data dir

Epitopes Make Data Dir Make Blast Dir Format NCBI blast file Create Epitoptes map file Load Epitopes map

InterproScan Make Data Dir Make InterproScan Cluster Task Input Dir Mirror InterproScan to Cluster Start Cluster Task Wait for Cluster Task Mirror InterproScan From Cluster Insert IprScan Results

Make and Block Candidate Assembly Seqs Make Candidate Assembly Seqs Extract Candidate Assembly Seqs Make Cluster Task Input Dir Mirror To Cluster Start Cluster Task Wait for Cluster Task Mirror From Cluster Make Data Dir

Map Candidate Assembly Seqs to Genome Extract Genomic Seqs into Separate Fasta Files Make Data Dir Make Gf Client Cluster Task Input Dir Mirror Gf Client to Cluster Mirror Gf Client From Cluster Insert BLAT Alignment Setbest BLAT Alignment Start GFCluster Task Wait for GF Cluster Task Run Nib On Cluster

Cluster Transcripts by Genome Alignment Put Unaligned Transcripts into One Cluster Assemble Transcripts Extract Assemblies Make Data Dir Make Repeat Mask Cluster Task Input Dir Mirror Assembly Repeat Mask To Cluster Start RM Task on Cluster Wait for RM Cluster Task Make and Block Assemblies

Make Data Dir Make Assembly Gf Client Cluster Task Input Dir Mirror Assembly Gf Client to Cluster Start GF Task on Cluster Wait for GF Cluster Task Mirror Gf Client From Cluster Insert BLAT Alignment Setbest BLAT Alignment Update Assembly Source Id Map Assemblies to Genome

Dump Mixed Genomic Sequences Make Repeat Mask Cluster Task Input Dir Mirror Repeat Mask To Cluster Start Cluster Task Wait for Cluster Task Mirror Virtual Sequence Repeat Mask From Cluster Make Data Dir Dump and Block Mixed Genome Seqs Move Blocked Seq File to Mercator Data Dir

Mercator Run MercatorMavid Create External Database and Release for Synteny from Mercator Insert Mercator Synteny Spans Make Mercator Gff File Correct Reading Frame in Mercator Gff file