Graphical representation of an amino acid or nucleic acid multiple sequence alignment developed by Tom Schneider and Mike.

Slides:

Advertisements

Similar presentations

Protein Structure 2 Higher Order Protein Structures.

Advertisements

CH. 11 : Transcriptional Control of Gene Expression Jennifer Brown.

Topic 7 Nucleic Acids and Proteins. DNA Structure.

• Exam II Tuesday 5/10 – Bring a scantron with you!

Regulatory Motifs. Contents Biology of regulatory motifs Experimental discovery Computational discovery PSSM MEME.

Alpha/Beta structures Barrels, sheets and horseshoes.

Amino Acids and Proteins 1.What is an amino acid / protein 2.Where are they found 3.Properties of the amino acids 4.How are proteins synthesized 1.Transcription.

Expect value Expect value (E-value) Expected number of hits, of equivalent or better score, found by random chance in a database of the size.

Sequence analysis June 18, 2008 Learning objectives-Understand the concept of sliding window programs. Understand difference between identity, similarity.

©CMBI 2008 Aligning Sequences The most powerful weapon in the bioinformaticist’s armory is sequence alignment. Why? Lets’ think about an alignment. It.

©CMBI 2005 Why align sequences? Lots of sequences with unknown structure and function. A few sequences with known structure and function If they align,

COUPLING BETWEEN TRANSCRIPTION AND mRNA PROCESSING.

Gyrase Mutation in Various Bacteria Leading to Fluoroquinolone (“Cipro”) Resistance By: Nancy Halliday Wesley Hanson Brenda Breeding.

© Wiley Publishing All Rights Reserved.

Transcription in eukaryotes

Sequence analysis: what is a sequence? Linear arrangement of chemical subunits Contains information: 3-D arrangement determined by the sequence; 3-D defines.

Protein Synthesis and Gene Mutation

Companion site for Biotechnology. by Clark Copyright © 2009 by Academic Press. All rights reserved. 1 Expression of Eukaryotic Proteins A bacterial Promoter/terminator.

Corrections. - The cacao genome is currently being sequenced - Human Chromosome 1 sequence Search ‘Genome’

Protein Synthesis and Gene Mutation

Construction of Substitution Matrices

Tertiary structure combines regular secondary structures and loops (coil) Bovine carboxypeptidase A.

GENOME: an organism’s complete set of genetic material Humans ~3 billion base pairs CHROMOSOME: Part of the genome; structure that holds tightly wound.

©CMBI 2009 Alignment & Secondary Structure You have learned about: Data & databases Tools Amino Acids Protein Structure Today we will discuss: Aligning.

A program of ITEST (Information Technology Experiences for Students and Teachers) funded by the National Science Foundation Background Session #3 DNA &

1 Protein synthesis How a nucleotide sequence is translated into amino acids.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Molecular Basis for Relationship between Genotype and Phenotype DNA RNA protein genotype function organism phenotype DNA sequence amino acid sequence transcription.

Exercises Pairwise alignment Homology search (BLAST) Multiple alignment (CLUSTAL W) Iterative Profile Search: Profile Search –Pfam –Prosite –PSI-BLAST.

©2001 Timothy G. Standish James 4:7 7Submit yourselves therefore to God. Resist the devil, and he will flee from you.

Polish Infrastructure for Supporting Computational Science in the European Research Space EUROPEAN UNION Examining Protein Folding Process Simulation and.

Transcription and Translation of DNA How does DNA transmit information within the cell? PROTEINS! How do we get from DNA to protein??? The central dogma.

Aidan Budd, EMBL Heidelberg Multiple Sequence Alignments.

Protein Sequence Alignment Multiple Sequence Alignment

Unit 1: DNA and the Genome Structure and function of RNA.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Arginine, who are you? Why so important?. Release 2015_01 of 07-Jan-15 of UniProtKB/Swiss-Prot contains sequence entries, comprising

Variation among organisms

6.4 The Building Blocks of Life

3.11 Proteins are essential to the structures and activities of life

Endoplasmic Reticulum

Introduction & overview

Figure 3.14A–D Protein structure (layer 1)

There are four levels of structure in proteins

Aligning Sequences You have learned about: Data & databases Tools

Relationship between Genotype and Phenotype

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Multiple sequence alignment and analysis of SOFL proteins.

Using The Genetic Code.

The future of protein secondary structure prediction accuracy

GLUTAMINASE - Phylogenetic tree construction

James 4:7 7 Submit yourselves therefore to God. Resist the devil, and he will flee from you.

The CARD15 (also known as NOD2) gene in Crohn's disease: Are there implications for current clinical practice? Jean–Frédéric Colombel Clinical Gastroenterology.

Different Genes ~ Protein Primary Structure

Volume 12, Issue 1, Pages (March 2004)

Protein domains Jasmin sutkovic

Genomic Sequence Analysis of the Mouse Desmoglein Cluster Reveals Evidence for Six Distinct Genes: Characterization of Mouse DSG4, DSG5, and DSG6 Neil.

Localization of the Iff8 extended protein.

AKAP15 coimmunoprecipitates with CaV1

Polymerases and the Replisome: Machines within Machines

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Relationship between Genotype and Phenotype

Structural features of Rps26a.

Introduction to this semester’s Praktikum

The NB-ARC domain: a novel signalling motif shared by plant resistance gene products and regulators of cell death in animals Erik A. van der Biezen,

A, protein structure and functional domains of hdbpB/YB-1, hdbpA, hdbpC, NF-YA, NF-YB, and NF-YC. A, protein structure and functional domains of hdbpB/YB-1,

Volume 97, Issue 6, Pages (June 1999)

Presentation transcript:

Graphical representation of an amino acid or nucleic acid multiple sequence alignment developed by Tom Schneider and Mike Stephens

Exercise: Identify conserved motif in the 50 bases upstream of 350 E. coli genes

Results

MOTIF Search

MOTIF Search N-linked glycosylation is important for the folding of some of eukaryotic proteins. Search the N-glycosylation site motif: Asn, followed by anything but Pro, followed by either Ser or Thr, followed by anything but Pro

Results

Horseshoe: Leucine-rich repeat

Domain architecture of proteins with Leucine- rich repeats Alignment of these proteins

Extract the amino acid sequence of the following protein: AAW55471 cytochrome oxidase subunit I [Butis butis] Duckbill sleepers (Butis butis) sometimes swim belly up.

Good luck with the final assignment!