Advanced Search dbGaP Closed captioning: www.captionedtext.com and enter 2790039www.captionedtext.com The recording, will be on our YouTube channel in.

Slides:



Advertisements
Similar presentations
The National Center for Biotechnology Information (NCBI) a primary resource for molecular biology information Database Resources.
Advertisements

The Rice Functional Genomics Program of China cDNA microarray database (RIFGP-CDMD) consists of complete datasets, including the probe sequences, microarray.
1 Welcome to the Protein Database Tutorial This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.
Pharmacy Information Resources TTUHSC Preston Smith Library presents Rev. 08/2014.
NCBI Elements of WGA n Phenotype Model n Genotype n Association between Phenotype Model and Genotype.
Biological Databases Notes adapted from lecture notes of Dr. Larry Hunter at the University of Colorado.
Overseas Library Catalog – Advanced Search Overseas Library Catalog Advanced Search by Keywords: “mass media” & “Middle East”
New Student Seminar LIBRARY INSTRUCTION Prof. Jacqueline A. Gill Ext Click the down or up arrows.
Wiley Online Library. About Wiley Online Library Wiley Online Library hosts the world's broadest and deepest multidisciplinary collection of online resources.
Access 2007 ® Use Databases How can Access help you to find and use information?
This guide demonstrates how to search for Dissertations and Theses from Aurora University and other institutions in the ProQuest database.
Gene Expression Omnibus (GEO)
Copyright OpenHelix. No use or reproduction without express written consent1.
Introduction to Bioinformatics CPSC 265. Interface of biology and computer science Analysis of proteins, genes and genomes using computer algorithms and.
This guide demonstrates how to access the I-Share catalog and how to have an item sent to the Aurora University Library. Information on creating an I-Share.
Searching PubMed® NCBI, NLM Resources, Micromedex -GSBS TTUHSC Preston Smith Library presents Rev. 08/17/14.
This walkthrough demonstrates how to search for eBooks in the EBSCO database.
Copyright OpenHelix. No use or reproduction without express written consent1.
Web Searching Basics Dr. Dania Bilal IS 530 Fall 2009.
1 Search Engines Emphasis on Google.com. 2 Discovery  Discovery is done by browsing & searching data on the Web.  There are 2 main types of search facilities.
QUT Library EndNote : Managing images. Adding images to EndNote records With EndNote Version 7, images may be embedded within records The Figure, Chart.
Introduction to the Gramene Genetic Diversity module 5/2010 Build #31.
Navigating the Long Term Care Tab. eSITE > Long Term Care eSITE Home Page.
National Levee Database Interactive Reports Instructions NLD Point of Contact 1 US Army Corps of Engineers.
This walkthrough demonstrates how to find out if the AU library has access to a journal either online or in print using the journal’s title.
Copyright OpenHelix. No use or reproduction without express written consent1.
Welcome Lab 2- Tools that Support your Online Business.
Copyright OpenHelix. No use or reproduction without express written consent1.
The World Wide Web: Information Resource. Hock, Randolph. The Extreme Searcher’s Internet Handbook. 2 nd ed. CyberAge Books: Medford. (2007). Internet.
Copyright OpenHelix. No use or reproduction without express written consent1.
Copyright OpenHelix. No use or reproduction without express written consent1.
Copyright OpenHelix. No use or reproduction without express written consent1.
I NTRODUCTION TO DATABASES - P RACTICAL. Q UERY S EQUENCE >my weird new protein MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT.
This tutorial will describe how to navigate the section of Gramene that provides descriptions of alleles associated with morphological, developmental,
3/18: Microsoft Access Refresher: What is a relational database? Why use a database? Sample database in MS access. –Fields, records, attributes. –Tables,
Copyright OpenHelix. No use or reproduction without express written consent1.
Finding What You’re Looking For Internet Search Tips.
Copyright OpenHelix. No use or reproduction without express written consent1.
Gramene V. 211 Gramene Diversity Gramene Genetic Diversity database contains SSR and SNP allelic data and passport descriptions for rice, maize and wheat.
Applied Bioinformatics Week 9 Jens Allmer. Theory I Gene Expression Microarray.
Copyright OpenHelix. No use or reproduction without express written consent1.
Copyright OpenHelix. No use or reproduction without express written consent1.
Midday: A Librarian’s Guide to NCBI DeDe Leshy, MLIS, MS June 19, 2013.
Copyright OpenHelix. No use or reproduction without express written consent1.
ADVANCED GOOGLE SEARCH TIPS AND TRICKS RACHEL LASZEWSKI.
Copyright OpenHelix. No use or reproduction without express written consent1.
Genomes at NCBI. Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools lists 57 databases.
Gramene V. 221 Gramene Diversity Gramene Genetic Diversity database contains SSR and SNP allelic data and passport descriptions for rice, maize and wheat.
Internet Search Techniques Finding What You’re Looking For.
PubMed Basics Barbara A. Wood, MLIS Calder Library University of Miami Miller School of Medicine.
Copyright OpenHelix. No use or reproduction without express written consent1.
database of Genotype and Phenotype
Introduction to Bioinformatics
Accessing the Catalog. An Introduction to Discovery: The New Catalog at the Dominican Theological Library.
Million Veteran Program Data Marts and Data Access
Understanding Search Engines
Using ArrayExpress.
Flowserve Distributor Online Store & Portal
CITY COLLEGE LIBRARIES
GALILEO Support Services September 2007
GALILEO Support Services September 2007
Searching the NCBI Databases
Flowserve Distributor Online Store & Portal
GALILEO Support Services September 2007
TAMU Bovine QTL db and viewer
This tutorial will demonstrate the advanced search options in WorldCat
Dissemination of the mcr-1 colistin resistance gene
(LOGO) Dogs (Dog picture) (Cat picture) Cats Contact (Contact picture) (random quote) FAQ (scrolling homepage with links to all the pages)
CREDIT CARD TUTORIAL HOW TO PERFORM TRANSACTION QUERY IN PAYMENTNET, SAVE IT, AND SET AS DEFAULT VIEW.
An updated PubMed is on its way!
Presentation transcript:

Advanced Search dbGaP Closed captioning: and enter www.captionedtext.com The recording, will be on our YouTube channel in the Webinars playlist: /user/NCBINLM/playlists Use the questions pod to ask questions when you think of them. Don’t wait until the end. Answers available after the webinar linked to our Webinars page: /home/coursesandwebinars.shtml /home/coursesandwebinars.shtml Materials / Q&A: 12/16/151

The Database of Genotypes and Phenotypes Human phenotype data and related individual-level molecular data / genotypes Data for more than than 1 million individuals across 645 studies Information about studies – individual level molecular and phenotype data – analysis results – medical images – general information about the study, – research protocols – questionnaires Molecular data types – Genotypes – Expression – Genomic Sequence – Epigenomic data – Somatic mutation – Microbiome Individual level data requires Controlled Access application and approval 12/16/152

dbGaP Homepage 12/16/15 New faceted advanced search interface 3

Faceted Search Interface 12/16/154 /projects/gapsolr/facets.html Filter Studies Variables Phenotype Datasets Documents Molecular Datasets Analyses By Study Keyword search Disease Study Design Molecular Data Type Marker Sets Filter Studies Variables Phenotype Datasets Documents Molecular Datasets Analyses By Study Keyword search Disease Study Design Molecular Data Type Marker Sets Breadcrumbs show current query, click to remove Keyword search across all

Live Demonstrations 12/16/155 Written narrative available:

More Resources Additional Tools – Phenotype/genotype integrator /gap/phegeni /gap/phegeni – dbGaP data browser /gap/ddb/ (authorized access) /gap/ddb/ Documentation and Help – dbGaP Help Document /books/NBK3837/ /books/NBK3837/ FAQ /books/NBK5295/ /books/NBK5295/ Factsheet /pub/factsheets/Factsheet_dbGaP.pdf /pub/factsheets/Factsheet_dbGaP.pdf – YouTube Channel /ncbinlm /ncbinlm – NCBI Factsheets /pub/factsheets/README_factsheets /pub/factsheets/README_factsheets – NCBI Help Desk – Webinars 12/16/156

Feedback: Privacy Policy Feedback
Do Not Sell My Personal Information
About project: SlidePlayer Terms of Service

© 2025 SlidePlayer.com. Inc. All rights reserved.