False negative HBsAg detectionFalse negative HBsAg detection n Is rare in patients with signs of chronic hepatitis B. n May be an issue in low-risk populations,

Slides:

Advertisements

Similar presentations

Egyptian Guidelines For Management of Chronic Hepatitis B

Advertisements

HCV Assays: Impact on HCV Studies & Update on HCV blood bank protocol.

Jean-Michel PAWLOTSKY

HBsAg+ candidate blood donors HBV genotypes Number Origin(s) A1 43 S. Africa A2 72 Poland B 126 Hong Kong Malaysia Taiwan Thailand C 90 Hong Kong Malaysia.

Treatment appropriate Normal or minimal hepatitis Chronic hepatitis Normal or inactive hepatitis Progressive fibrosis Cirrhosis HCC HBeAg Anti-HBe HBV.

CORRELATION BETWEEN HBSAG LEVEL AND VIRAL LOAD

Impact of Testing Strategies to Reduce Transmission Risk for HBV Ravi Reddy, M Vermeulen South African National Blood Service (SANBS) 29 July 2013.

HCV-HBV co-infection in Russian Federation Chumakov Institute of Poliomyelitis and Viral Encephalitis, Moscow Karen Kyuregyan VIII Annual Conference of.

Laboratory Diagnostics in Hepatitis

TELBIVUDINE FOR THE TREATMENT OF CHRONIC HEPATITIS B: A CASE SERIES N.K. Gatselis, K. Zachou, E.I. Rigopoulou, G. Papadamou, K. Galanis G.N. Dalekos Department.

IMPACT OF ORGAN AND NON-ORGAN-SPECIFIC AUTOANTIBODIES ON THE TREATMENT OUTCOME OF PATIENTS WITH HEPATITIS D VIRUS INFECTION 1 Department of Gastroenterology,

F. Kourgia, M. Vini, E. Zervou

HEPATITIS B MARKERS AND VACCINE

Screening for HBsAg and Anti-HBc in North American Blood Donors John Saldanha, Roche Molecular Systems SoGAT XXI, May, 2009, Brussels, Belgium.

Testing Source Plasma for Hepatitis B Virus by Nucleic Acid Testing Blood Products Advisory Committee Meeting Blood Products Advisory Committee Meeting.

3 rd Paris Hepatitis Conference January, 20th 2009 How to optimize the management of my HBeAg negative patients? Pietro Lampertico 1st Gastroenterology.

Full characterization of HAV RNA window period positive blood donations in Germany SoGAT XVIII Bethesda.

Mixed HCV Genotype Infection and Response to anti-HCV treatment in HIV/HCV Co-Infected Patients Lucy Porrino, Sabrina Bagaglio, Giulia Morsica, Giulia.

Limitations of HBsAg testing in the screening of blood donors Wolfram H. Gerlich Institute of Medical Virology University Giessen, Germany SoGAT XVI Langen.

Faculty of Allied Medical Sciences Clinical Immunology & Serology Practice (MLIS 201)

SPRINT-2/RESPOND-2 Boceprevir Plus Standard of Care Phase 3 Clinical Trials Analysis of Resistance Associated Variants by HCV Genotype 1 subtypes 1a and.

BioLife Plasma Services Experience with HBV NAT Testing

Hepatitis B virus Hepatitis viruses: A B formerly serum hepatitis D non A nonB E G.

Detection of parvovirus B19 and novel human parvoviruses in high-risk individuals Ashleigh Manning 1, Kate Templeton 2, Ed. Gomperts 3, Peter Simmonds.

PREVAC B Management of hepatitis B prevention among migrants AASLD, San Francisco, 2008 AUBERT Jean-Pierre DI PUMPO Alexandrine SANTANA Pascale GERVAIS.

Hepatitis B virus Hepatitis viruses: A B formerly serum hepatitis C D non A nonB E G.

Reentry for Donors Deferred Based on Anti-HBc Test Results November 3, 2005 BPAC Meeting FDA/CBER/OBRR/DETTD.

HBV-DNA detection by hybridization assay in the serum of anti-HBe positive HBV carriers HBV-DNA + Chronic Hepatitis 11/19 58% 11/14 79% Bonino /13.

Lara Isobel Compston, Daniel Candotti, Jean-Pierre Allain

Persistent human erythrovirus infection in blood donors National Blood Service, UK Div. Transfusion Medicine, University of Cambridge, UK Public Health.

CHRONIC HEPATITIS B SEROLOGY. Antigens HBsAg -Found on the surface of the intact virus and in serum as unattached particles -Earliest detectable marker.

Occult hepatitis B virus (HBV) and hepatitis C virus (HCV) viremia in women with and at-risk for HIV/AIDS Taylor L, Gholam P, Delong A, Rompalo A, Klein.

Survey of hepatites VirusRelationshipTransmission HAVPicornavirusfaecal-oral HBVSpecial group of DNA viruses sexual, blood HCV (+ HGV)Flavivirusblood HDVDelta.

Stability of HCV, HIV-1 and HBV nucleic acids in plasma samples stored at different temperatures Marta José, Rodrigo Gajardo and Juan I. Jorquera Instituto.

21th VHPB Meeting on “Prevention of viral hepatitis in Italy: lessons learnt and the way forward” Catania, 7-8 november 2002 Impact of HBV S-gene mutants.

1 Preparation of Standard Paneled Plasma for HBV, HCV, and HIV-1 in Japan Hisao Yugi Japanese Red Cross Central Blood Center Study Group of the Ministry.

SoGAT June 14, 2006 HCV-RNA and HIV-RNA detection in small test pools of cadaveric samples for viral safety of tissue transplants Maarten Koot#,

Development of Standard Reagents for WNV NAT M. Rios, A. Grinev, K. Sirnivasan, O. Wood, S. Daniel, I. Hewlett CBER/FDA.

HBV screening Further improvement of blood safety based on the knowledge deduced from the results on analysis of the donor’s sera positive for HBV DNA.

GI BLOCK; This practical class is designed and Prepared by: Prof. Samy A. Azer (Medical Education) Dr. Ali Somily (Microbiology) Prof. Abdul Mageed.

Natural history of HBV infection (adapted from Torbenson Lancet 2003) Chronic infection Healthy carriage Recovery occult DNA Anti-HBe Anti-HBc Immune response.

E B—Anti-HBc Chart 1 10/2004 Anti-HBc Testing and Donor Reentry Results of a Pilot Study Susan L. Stramer, Ph.D. American Red Cross Blood Products.

Phar. Nhat Mang/ Roche Vietnam

Evaluation of Hepatitis B surveillance system in Armenia, 2014 AUTHORS Karine Gevorgyan Lusine Paronyan Shushan Sargsyan Artavazd Vanyan NCDC, Armenia.

Isolated Hepatitis B Core Antibody

HEPATITIS B VIRUS. Discovery and Development. Baruch S. Blumberg Fox Chase Cancer Center, Philadelphia PA, USA.

Serologic markers and molecular epidemiology of HBV from an HIV infected cohort from Cameroon Tshifhiwa Magoro 1, Emmaculate Nongpang 2, Lufuno Mavhandu.

CHRONIC HEPATITIS B SEROLOGY

HBV viral load 측정 및 임상적 의의 진단검사의학과이희주 Content v 임상적 의의 v 측정법.

Clinicaloptions.com/hepatitis Using Virologic and Serologic Tests in the Management of Hepatitis B Diagnose chronic HBV infection When in slideshow mode,

Entecavir Superior to Lamivudine for Treatment of Nucleoside-Naive, HBeAg- Negative Patients Slideset on: Lai CL, Shouval D, Lok AS, et al. Entecavir versus.

MICROBIOLOGY IRS. Gastroenteritis 1) Major cause of infantile death 2) Feacal-oral transmission 3) Gastroenteritis cause dehydration 4) 50 % of all causes.

Hepatitis B virus infection in renal transplant recipients

Viral Hepatitis.

by Paul A. Carpenter, Meei-Li Huang, and George B. McDonald

Laboratory Diagnostics in Viral Hepatitis

In The Name of God.

Dr Iyat Abdul Sattar A study on the clinical & serolological markers of HBV among patients with chronic HBV infection in Babylon Dr Monem Makki Alshok.

GRIFOLS PLASMA: genotype 2 vB19 sample

Vrushali Patwardhan, Dinesh Kumar, Varun Goel, Sarman Singh

Volume 134, Issue 5, Pages (May 2008)

by Paul A. Carpenter, Meei-Li Huang, and George B. McDonald

Distributions of parvovirus B19 genotype 1-3 in blood donations

Efficacy of Serologic Marker Screening in Identifying Hepatitis B Virus Infection in Organ, Tissue, and Cell Donors Dominique Challine, Stéphane Chevaliez,

Comparison of a commercial and ‘in house’ assay for B19 DNA

Clinicaloptions.com/hepatitis Using Virologic and Serologic Tests in the Management of Hepatitis B Diagnose chronic HBV infection When in slideshow mode,

Volume 42, Issue 6, Pages (June 2005)

Figure 2 Distribution of markers of active HBV infection

SoGAT meeting XXI May (2009), Brussels, Belgium

Role for HCV antigen detection: a new generation of assays

Presentation transcript:

False negative HBsAg detectionFalse negative HBsAg detection n Is rare in patients with signs of chronic hepatitis B. n May be an issue in low-risk populations, such as: –blood donors, –organ, tissue and cell donors. It may result of:It may result of: n Undetectable, low-level HBsAg. n Substitutions in HBsAg “Major Hydrophilic Region”: –located at positions 99 to 160, –encompasses the “a” determinant, a major HBV epitope. False-Negative HBsAg Detection in Chronic Hepatitis B

Mutations in “a” Determinant A R D 144 G S-S S-S --S-S S-S Loop 1 of “a” determinant Loop 2 of “a” determinant HBs1 HBs2 HBs3 HBs4 HBs5 141 K T 126 N Q 129 H M 133 L E

Aims of the Study To determine the prevalence of falsely negative HBsAg detection in a large population of organ, tissue and cell donors.To determine the prevalence of falsely negative HBsAg detection in a large population of organ, tissue and cell donors. To understand the role of HBsAg mutants in the lack of HBsAg detection in HBV DNA positive donors.To understand the role of HBsAg mutants in the lack of HBsAg detection in HBV DNA positive donors.

Patients 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti- HBc Ab, anti-HBs Ab) between May 2000 and May 2004: 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti- HBc Ab, anti-HBs Ab) between May 2000 and May 2004:  First group: donors (5.6%), - with at least one of the three HBV serological markers, - excluding vaccination profiles (anti-HBs Ab alone).

11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti- HBc Ab, anti-HBs Ab) between May 2000 and May 2004: 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti- HBc Ab, anti-HBs Ab) between May 2000 and May 2004:  First group: donors (5.6%), -Brain-dead, heart-beating organ donors -Living organ donors -Tissue donors -Stem cell donors -Cord blood donors -Cornea donors Patients

11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti- HBc Ab, anti-HBs Ab) between May 2000 and May 2004: 11,155 organ, tissue and cell donors were systematically tested for the presence of HBV markers (e.g. HBsAg, anti- HBc Ab, anti-HBs Ab) between May 2000 and May 2004:  First group : donors (5.6%), - with at least one of the three HBV serological markers, - excluding vaccination profiles (anti-HBs Ab alone).  Second group: brain-dead organ donors, - seronegative for HBV or with anti-HBs Ab only. Patients

Methods (1) HBsAg was assessed with 3 different assays:HBsAg was assessed with 3 different assays: n Vitros Eci TM (Ortho-Clinical Diagnostics), n Architect TM (Abbott), n Vidas TM (BioMérieux). HBV DNA was systematically sought by means of a real-time PCR assay:HBV DNA was systematically sought by means of a real-time PCR assay: n Cobas TaqMan HBV (Roche Molecular Systems), n Lower limit of detection: 6 IU/ml, n Dynamic range of quantification: IU/ml.

Full-length preS1-preS2-HBsAg sequence was determined in all HBV DNA-positive donors:Full-length preS1-preS2-HBsAg sequence was determined in all HBV DNA-positive donors: n Nested PCR using previously described primers a n Direct sequencing, n Alignment of sequences with prototype strains of HBV genotypes A to H. a Stuyver et al., J Gen Virol 2000 Methods (2)

HBV DNA in HBsAg-positive Donors 3.3 log IU/ml 2.5 log IU/ml 5.4 log IU/ml 2.0 log IU/ml 2.7 log IU/ml Brain-dead organ donors (n = 199) Living organ donors (n = 13) TissueDonors (n = 165) Cord blood Donors (n = 56) Stem cell Donors (n = 75) CorneaDonors (n = 118) 17/20 (85%) 2/2 (100%) 3/5 (60%) 2/2 (100%) 1/8 (12.5%) 20% 40% 60% 80% 100% 0%

HBV DNA in Donors with Isolated Anti-HBc Ab 1.6 log IU/ml 3.6 log IU/ml 20% 40% 60% 80% 100% 0% 2/53 (3.8%) 2/21 (9.5%) Brain-dead organ donors (n = 199) Living organ donors (n = 13) TissueDonors (n = 165) Cord blood Donors (n = 56) Stem cell Donors (n = 75) CorneaDonors (n = 118)

2.4 log IU/ml 20% 40% 60% 80% 100% 0% 3/62 (4.8%) HBV DNA in Donors with Both Anti-HBc and Anti-HBs Ab Brain-dead organ donors (n = 199) Living organ donors (n = 13) TissueDonors (n = 165) Cord blood Donors (n = 56) Stem cell Donors (n = 75) CorneaDonors (n = 118)

3.5 log IU/ml 3.6 log IU/ml 20% 40% 60% 80% 100% 0% 2/5 (40%) 1/27 (3.7%) HBV DNA in Donors with Three Markers Brain-dead organ donors (n = 199) Living organ donors (n = 13) TissueDonors (n = 165) Cord blood Donors (n = 56) Stem cell Donors (n = 75) CorneaDonors (n = 118)

HBsAg Gen A: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH HBsAg Gen B: HBsAg Gen C:....A..L S..K.....L ET QI.S. HBsAg Gen D: TT HBsAg Gen E:..S K A HBsAg Gen F: L....R....VC....K L.R.P HBsAg Gen G: L....R....VC....K L.R.P HBsAg Gen H: L.R VC....K VP.G.P I... HBsAg-9 :..S K A HBsAg-10 :....A..L K T QI.S. HBsAg-11 :...T E G A.P.....L HBsAg-12 : HBsAg-13 : ENT HBsAg-14 : L F.... L F S.... A S HBsAg-16 : A V S L S F.S...EA C..... HBsAg-18 :...T A.K.P...L HBsAg-19 :..ST A.T.P HBsAg-20 : TT HBsAg-21 : L.R K R HBsAg-23 :..K....S TT HBsAg-24 :..S K A HBsAg-27 : TT HBsAg-147 : K Q TT HBsAg-148 : N NT HBsAg-149 : A V S L..... T I T I. Q R P L. E G A..... Q L HBsAg-150 :....A..L K TH QI.S. HBsAg-153 :..S K A S. HBsAg-154 : TT HBsAg-29 : HBsAg-112 : V...P.L HBsAg-143 : TT HBsAg-144 :....A..L K T Q..S. HBsAg-145 : TT HBsAg Sequence Analysis Group 1 HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers 45 Reference prototype strains of A to H genotypes

HBsAg Gen A: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH HBsAg Gen B: HBsAg Gen C:....A..L S..K.....L ET QI.S. HBsAg Gen D: TT HBsAg Gen E:..S K A HBsAg Gen F: L....R....VC....K L.R.P HBsAg Gen G: L....R....VC....K L.R.P HBsAg Gen H: L.R VC....K VP.G.P I... HBsAg-9 :..S K A HBsAg-10 :....A..L K T QI.S. HBsAg-11 :...T E G A.P.....L HBsAg-12 : HBsAg-13 : ENT HBsAg-14 : L F.... L F S.... A S HBsAg-16 : A V S L S F.S...EA C..... HBsAg-18 :...T A.K.P...L HBsAg-19 :..ST A.T.P HBsAg-20 : TT HBsAg-21 : L.R K R HBsAg-23 :..K....S TT HBsAg-24 :..S K A HBsAg-27 : TT HBsAg-147 : K Q TT HBsAg-148 : N NT HBsAg-149 : A V S L..... T I T I. Q R P L. E G A..... Q L HBsAg-150 :....A..L K TH QI.S. HBsAg-153 :..S K A S. HBsAg-154 : TT HBsAg-29 : HBsAg-112 : V...P.L HBsAg-143 : TT HBsAg-144 :....A..L K T Q..S. HBsAg-145 : TT HBsAg Sequence Analysis Group 1 45 HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers Reference prototype strains of A to H genotypes

HBsAg Gen A: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH HBsAg Gen B: HBsAg Gen C:....A..L S..K.....L ET QI.S. HBsAg Gen D: TT HBsAg Gen E:..S K A HBsAg Gen F: L....R....VC....K L.R.P HBsAg Gen G: L....R....VC....K L.R.P HBsAg Gen H: L.R VC....K VP.G.P I... HBsAg-9 :..S K A HBsAg-10 :....A..L K T QI.S. HBsAg-11 :...T E G A.P.....L HBsAg-12 : HBsAg-13 : ENT HBsAg-14 : L F.... L F S.... A S HBsAg-16 : A V S L S F.S...EA C..... HBsAg-18 :...T A.K.P...L HBsAg-19 :..ST A.T.P HBsAg-20 : TT HBsAg-21 : L.R K R HBsAg-23 :..K....S TT HBsAg-24 :..S K A HBsAg-27 : TT HBsAg-147 : K Q TT HBsAg-148 : N NT HBsAg-149 : A V S L..... T I T I. Q R P L. E G A..... Q L HBsAg-150 :....A..L K TH QI.S. HBsAg-153 :..S K A S. HBsAg-154 : TT HBsAg-29 : HBsAg-112 : V...P.L HBsAg-143 : TT HBsAg-144 :....A..L K T Q..S. HBsAg-145 : TT HBsAg Sequence Analysis Group 1 HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers Reference prototype strains of A to H genotypes

HBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC HBsAg Gen B: HBsAg Gen C: T HBsAg Gen D: R....T...T..Y S HBsAg Gen E: R..M.L...T S..S HBsAg Gen F:....AL...T S..S HBsAg Gen G:....AL...T S..S HBsAg Gen H:.....L...T S HBsAg-9 : R....L...T S..S HBsAg-10 : T HBsAg-11 :. M R T I......T S HBsAg-12 : RL HBsAg-13 : R T..Y S HBsAg-14 : HBsAg-16 : HBsAg-18 :....I....T S HBsAg-19 :....I....T T S..S HBsAg-20 : R T..Y S HBsAg-21 : T HBsAg-23 : R T..Y S HBsAg-24 : R....L...T S..S HBsAg-27 : R..M.T...T..Y S HBsAg-147 : R T..Y S HBsAg-148 : R T..Y S HBsAg-149 : HBsAg-150 : R......H.T HBsAg-153 : R....L...T S..S HBsAg-154 : R T..Y S HBsAg-29 : R HBsAg-112 : Y S HBsAg-143 : R A..Y S HBsAg-144 : T HBsAg-145 : R..M.T...T..Y S “a” Determinant Sequence Analysis Group 1 Reference prototype strains of A to H gentotypes HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers

HBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC HBsAg Gen B: HBsAg Gen C: T HBsAg Gen D: R....T...T..Y S HBsAg Gen E: R..M.L...T S..S HBsAg Gen F:....AL...T S..S HBsAg Gen G:....AL...T S..S HBsAg Gen H:.....L...T S HBsAg-9 : R....L...T S..S HBsAg-10 : T HBsAg-11 :. M R T I......T S HBsAg-12 : RL HBsAg-13 : R T..Y S HBsAg-14 : HBsAg-16 : HBsAg-18 :....I....T S HBsAg-19 :....I....T T S..S HBsAg-20 : R T..Y S HBsAg-21 : T HBsAg-23 : R T..Y S HBsAg-24 : R....L...T S..S HBsAg-27 : R..M.T...T..Y S HBsAg-147 : R T..Y S HBsAg-148 : R T..Y S HBsAg-149 : HBsAg-150 : R......H.T HBsAg-153 : R....L...T S..S HBsAg-154 : R T..Y S HBsAg-29 : R HBsAg-112 : Y S HBsAg-143 : R A..Y S HBsAg-144 : T HBsAg-145 : R..M.T...T..Y S Reference prototype strains of A to H gentotypes HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers “a” Determinant Sequence Analysis Group 1

HBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC HBsAg Gen B: HBsAg Gen C: T HBsAg Gen D: R....T...T..Y S HBsAg Gen E: R..M.L...T S..S HBsAg Gen F:....AL...T S..S HBsAg Gen G:....AL...T S..S HBsAg Gen H:.....L...T S HBsAg-9 : R....L...T S..S HBsAg-10 : T HBsAg-11 :. M R T I......T S HBsAg-12 : RL HBsAg-13 : R T..Y S HBsAg-14 : HBsAg-16 : HBsAg-18 :....I....T S HBsAg-19 :....I....T T S..S HBsAg-20 : R T..Y S HBsAg-21 : T HBsAg-23 : R T..Y S HBsAg-24 : R....L...T S..S HBsAg-27 : R..M.T...T..Y S HBsAg-147 : R T..Y S HBsAg-148 : R T..Y S HBsAg-149 : HBsAg-150 : R......H.T HBsAg-153 : R....L...T S..S HBsAg-154 : R T..Y S HBsAg-29 : R HBsAg-112 : Y S HBsAg-143 : R A..Y S HBsAg-144 : T HBsAg-145 : R..M.T...T..Y S Reference prototype strains of A to H gentotypes HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers “a” Determinant Sequence Analysis Group 1

HBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC HBsAg Gen B: HBsAg Gen C: T HBsAg Gen D: R....T...T..Y S HBsAg Gen E: R..M.L...T S..S HBsAg Gen F:....AL...T S..S HBsAg Gen G:....AL...T S..S HBsAg Gen H:.....L...T S HBsAg-9 : R....L...T S..S HBsAg-10 : T HBsAg-11 :. M R T I......T S HBsAg-12 : RL HBsAg-13 : R T..Y S HBsAg-14 : HBsAg-16 : HBsAg-18 :....I....T S HBsAg-19 :....I....T T S..S HBsAg-20 : R T..Y S HBsAg-21 : T HBsAg-23 : R T..Y S HBsAg-24 : R....L...T S..S HBsAg-27 : R..M.T...T..Y S HBsAg-147 : R T..Y S HBsAg-148 : R T..Y S HBsAg-149 : HBsAg-150 : R......H.T HBsAg-153 : R....L...T S..S HBsAg-154 : R T..Y S HBsAg-29 : R HBsAg-112 : Y S HBsAg-143 : R A..Y S HBsAg-144 : T HBsAg-145 : R..M.T...T..Y S Reference prototype strains of A to H gentotypes HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers “a” Determinant Sequence Analysis Group 1

Reference prototype strains of A to H gentotypes HBsAg-positive donors Isolated anti-HBc Ab donors Donors with three serological markers “a” Determinant Sequence Analysis Group 1 HBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC HBsAg Gen B: HBsAg Gen C: T HBsAg Gen D: R....T...T..Y S HBsAg Gen E: R..M.L...T S..S HBsAg Gen F:....AL...T S..S HBsAg Gen G:....AL...T S..S HBsAg Gen H:.....L...T S HBsAg-9 : R....L...T S..S HBsAg-10 : T HBsAg-11 :. M R T I......T S HBsAg-12 : RL HBsAg-13 : R T..Y S HBsAg-14 : HBsAg-16 : HBsAg-18 :....I....T S HBsAg-19 :....I....T T S..S HBsAg-20 : R T..Y S HBsAg-21 : T HBsAg-23 : R T..Y S HBsAg-24 : R....L...T S..S HBsAg-27 : R..M.T...T..Y S HBsAg-147 : R T..Y S HBsAg-148 : R T..Y S HBsAg-149 : HBsAg-150 : R......H.T HBsAg-153 : R....L...T S..S HBsAg-154 : R T..Y S HBsAg-29 : R HBsAg-112 : Y S HBsAg-143 : R A..Y S HBsAg-144 : T HBsAg-145 : R..M.T...T..Y S......

PreS1-PreS2 Sequence Analysis Group 1 No specific features were observed in the preS1 and preS2 regions in the donors with no detectable HBsAg compared to HBsAg positive donors.No specific features were observed in the preS1 and preS2 regions in the donors with no detectable HBsAg compared to HBsAg positive donors.

Frequency of HBV DNA Detection in the Second Study Group Brain-dead organ donors Seronegative Anti-HBs alone TOTALn HBV DNA + confirmed 011

HBsAg Gen A: KTCTTPAQGNSMFPSCCCTKPTDGNCTC HBsAg Gen B: HBsAg Gen C: T HBsAg Gen D: R....T...T..Y S HBsAg Gen E: R..M.L...T S..S HBsAg Gen F:....AL...T S..S HBsAg Gen G:....AL...T S..S HBsAg Gen H:.....L...T S HBsAg-122 : R....L.PST..Y S “a” Determinant Sequence Analysis Group 2 Reference prototype strains of A to H genotypes Vaccinated donors Position 129

PreS1-preS2 Sequence Analysis Group 2 No additional preS1 or preS2 changes were observed that could explain the lack of HBsAg detection in this donor.No additional preS1 or preS2 changes were observed that could explain the lack of HBsAg detection in this donor.

HBV DNA:HBV DNA: n is detected in most HBsAg-positive organ, tissue and cell donors, n can be detected in HBsAg-negative donors, with or without anti-HBc Ab. In HBV DNA-positive donors, whatever their serological profile, the level of HBV replication is substantially lower than in patients with chronic hepatitis B.In HBV DNA-positive donors, whatever their serological profile, the level of HBV replication is substantially lower than in patients with chronic hepatitis B. Conclusions (I)

The lack of HBsAg detection in our study could not be explained by HBsAg or preS1-preS2 amino acid substitutions (except in one donor without any HBV serological marker).The lack of HBsAg detection in our study could not be explained by HBsAg or preS1-preS2 amino acid substitutions (except in one donor without any HBV serological marker). The lack of HBsAg detection was most likely related to a lack of sensitivity of enzyme immunoassays for low-level HBsAg in individuals with low-level viral replication.The lack of HBsAg detection was most likely related to a lack of sensitivity of enzyme immunoassays for low-level HBsAg in individuals with low-level viral replication. Conclusions (II)

Organ, tissue and cell transplantation safety may greatly benefit from:Organ, tissue and cell transplantation safety may greatly benefit from: n Implementation of highly-sensitive HBsAg assays. n Implementation of highly-sensitive HBV DNA detection assays. Perspectives

French National Reference Center for Viral Hepatitis B, C and Delta, Department of Virology, INSERM U 635 Hôpital H. Mondor, Université Paris XII, Créteil Dominique CHALLINE Stéphane CHEVALIEZ Rozenn BRILLET Jean-Michel PAWLOTSKY