Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

Slides:

Advertisements

Similar presentations

The Protein Data Bank (PDB)

Advertisements

Multiple sequence alignment and alignment editor.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

Supplemental Fig. S1 Ihsan et al., 2015 Supplemental Fig. S1 Sequence analysis of Solanaceous MAGO NASHI genes. ClustalW multiple alignments of nucleotide.

Are Euglena plants or animals?. NEITHER! Euglena are protists: a single celled, eukaryotic organism Some euglena have chloroplasts Some euglena are highly.

Bikash Shakya Emma Lang Jorge Diaz.  BLASTx entire sequence against 9 plant genomes. RepeatMasker  55.47% repetitive sequences  82.5% retroelements.

Levels of Protein Structure

Suplemental Data Figure S1. Alignment of deduced amino acid sequence of CaGA2ox1 and other GA2ox homologs from the pepper EST database. Dark shading indicates.

Supplemental Figure 1S. Alignment and phylogeny of CRY proteins. Comparison of the amino acid sequences of the DNA-photolyase domain (a) and FAD binding.

Comparison of p53 Structure: Wild type vs. mutant What change in wild type p53 may lead to cancer?

COURSE OF BIOINFORMATICS Exam_31/01/2014 A.

Construction of Substitution Matrices

Fig. S1. Amino acid sequence alignment of MYBS3 proteins. MYBS3 protein sequences of Arabidopsis thaliana (MYBH; NP_199550); (At3g16350; NP_188256), Glycine.

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

Arabidopsis Thaliana A Study of Genes and Embryo Development By Garen Polatoglu.

COURSE OF BIOINFORMATICS Exam_30/01/2014 A.

Graphical representation of an amino acid or nucleic acid multiple sequence alignment developed by Tom Schneider and Mike.

Supplementary Fig 1. Multiple sequence alignment of nucleotide sequences from amplified region of different Oryza sativa lines and wild species of rice.

Molecular Evolution. Study of how genes and proteins evolve and how are organisms related based on their DNA sequence Molecular evolution therefore is.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.

T+3 WL kDa pI Supplementary Fig. 1.　Confirmation of the.

Fig. 1. Alignment of NaHD20 amino acid sequences with HD-Zip I proteins from different plant species. Multiple alignment of the NaHD20 amino acid sequence.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Alignment table: group 4

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Supplementary Materials

Supplementary Figure 1 ORF2 ORF3 Nelorpivirus (Group I Negevirus)

Have (y)Our Protein Explained

HEMOGLOBIN Lindsey Kim.

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Molecular Evolution.

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Multiple sequence alignment and analysis of SOFL proteins.

Prediction of protein structure

Volume 2, Issue 4, Pages (July 2009)

Volume 3, Issue 2, Pages (March 2010)

A Novel MAP Kinase Regulates Flagellar Length in Chlamydomonas

Where would you draw the polyA tail in the gene above?______________

Amino acid alignment of TprK showing six different sequences in the T

W. Ibrahim, N. Boukhadra, D. Nasri-Zoghlami, P. Berthelot, S. Omar, T

Marco Gallio†, Per Kylsten† Current Biology

Supplementary Fig. 1. Sequence alignment between s from diverse species Supp Fig 1: Sequence alignment of uncharacterized family protein,

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Elizabeth S. Haswell, Elliot M. Meyerowitz Current Biology

Takahiro Watanabe, Kunihiko Tamaki

Alex Bateman, Cyrus Chothia Current Biology

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

The Gene Mutated in Variant Late-Infantile Neuronal Ceroid Lipofuscinosis (CLN6) and in nclf Mutant Mice Encodes a Novel Predicted Transmembrane Protein

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Figure 1 Pedigree and genetic findings

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

General structure of RIFINs and STEVORs

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

(A) Segregation of mutations in TMEM231 in JBTS families.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

M L L L V L L V V L I L L I V R R Predicted transmembrane domain

Mutations in the Human Orthologue of the Mouse underwhite Gene (uw) Underlie a New Form of Oculocutaneous Albinism, OCA4 J.M. Newton, Orit Cohen-Barak,

Volume 7, Issue 12, Pages (December 2014)

L. Aravind, Eugene V. Koonin Current Biology

Comparison of the van gene clusters.

C. neoformans encodes a single family 2 DHODH required for wild-type growth. C. neoformans encodes a single family 2 DHODH required for wild-type growth.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Presentation transcript:

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes Kharchia 65, HD 2009, HD 2687 and WL 711 with O. sativa japonica (GeneBank Acc. No. AY ) and A. thaliana (GeneBank Acc. No. NM_ ) (* shows conserved amino acids), putative transmembrane domains are denoted by numerals predicted by TMHMM program.AY

Supplementary Fig. 2 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS2 in root tissues of wheat genotypes Kharchia 65, HD 2009, HD2687 and WL711 with O. sativa japonica (GeneBank Acc. No. EU ) and A. thaliana (GeneBank Acc. No. NM_ ) (* shows conserved amino acids).EU

Supplementary Fig. 3 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS3 in root tissues of wheat genotypes Kharchia 65, HD 2009, HD 2687 and WL 711 with O. sativa japonica (Gene Bank Acc. No. DQ ) and A. thaliana (Gene Bank Acc. No. NM_ ) (* shows conserved amino acids)DQ

Supplementary Fig. 4 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of VP1 in leaf tissues of wheat genotypes Kharchia 65, HD 2009, HD2687 and WL711 with O. sativa japonica (GeneBank Acc. No. D ) and A. thaliana (GeneBank Acc. No. AB ) (* shows conserved amino acids) putative transmembrane domains are denoted by numerals predicted by TMHMM program.

Supplementary Fig. 5 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of NHX1 in leaf tissues of wheat genotypes Kharchia 65, HD 2009, HD2687 and WL711 with O. sativa japonica (GeneBank Acc. No. AB ) and A. thaliana (GeneBank Acc. No. AK ) (* shows conserved amino acids) putative transmembrane domains are denoted by numerals predicted by TMHMM program.AB AK