The Detection of expressed IL-32 in the Human Stomach Cancer using an ELISA and Immunostaining. Seo, Eun-Hee October 6, 2008 Lab of Cell Biol& ImmunoBiochem.

Slides:



Advertisements
Similar presentations
Applications of Biotechnological Processes Antibody Production.
Advertisements

antibodies produced by differentiated B-cells
Antibodies Analytical Techniques Utilizing Antibodies: flow cytometry
Enzyme Linked Immunosorbent Assay
ELISA Enzyme Linked Immunosorbent Assay. Definitions  Antibodies (also known as immunoglobulins abbreviated Ig) are gamma globulin proteins that are.
Monoclonal Antibodies
© 2004 Wadsworth – Thomson Learning Immunology Tutorial Introduction & Course outline By: Moh’d J. Al Khatatneh.
Monoclonal Antibodies. Antibodies have important uses beyond fighting infections in the body. Production of long-lasting monoclonal antibodies is a recent.
Measurement in Science Bioassays and Immunoassays Karim Meeran 23 October 2009.
Introduction to Immunoassays
Enzyme-linked Immunosorbent Assay
Biopharmaceutical Products Touqeer Ahmed Ph.D. Atta-ur-Rahman School of Applied Bioscience, National University of Sciences and Technology 23 rd September,
“MONOCLONAL ANTIBODIES” Jony Mallik M
Altogen Labs, 4020 S Industrial Dr, Suite 130, Austin TX 78744, USA  ELIS A Enzyme-Linked Immunosorbent Assay ELISA.
Monoclonal antibodies Hybridoma Technique. Monoclonal antibodies (mAb or moAb) Monoclonal antibodies are:  monospecific antibodies that are identical.
Department of Biotechnology and Microbiology
(Enzyme Linked Immunosorbent Assay)
The effect of TCDD on cytokine production during the progression of insulitis in NOD mice Tuan Pham Dr. Nancy Kerkvliet Environmental and Molecular Toxicology.
Lec 16 Medical biotechnology Shah Rukh Abbas, PhD
Construction, Transformation, and Prokaryote Expression of a Fused GFP and Mutant Human IL-13 Gene Sequence Lindsay Venditti, Department of Biological.
Antibody Fab region bound to a sequential antigen
ABDUALLAH SAUD AL-SHETELY
ANALYTICAL AND PREPARATIVE METHODS BASED ON PRIMARY ANTIGEN-ANTIBODY BINDING IMMUNOAFFINITY CHROMATOGRAPHY ELISA.
Enzyme-Linked Immunosorbent Assay
H. HogenEsch, 2005 Antibody structure and function Parham – Chapter 2.
ELISA (aka Enzyme-Linked Immunosorbent Assay) Professor C. Roth 125:315: BME Measurements and Analysis Laboratory Spring 2003.
Enzyme Linked Immunosorbent Assay (ELISA). ELISA Enzyme Linked Immunosorbent Assay (ELISA) Term Was Coined By Engvall and Pearlmann in 1971 Different.
Enzyme-Linked Immunosorbent Assay [ELISA] BCH 462[practical] Lab#5.
Exp Ⅴ 1. Enzyme-linked Immunosorbent Assay(ELISA) 2
ELISA Assay. What Is It? Enzyme immunoassay (EIA) is a test used to detect and quantify specific antigen-eliciting molecules involved in biological processes,
CHOIRUNIL CHOTIMAH INTRODUCTION Leishmaniasis Leishmania Parasites promastigotes amastigotes Difficult to treat Need effective vaccine.
Antibodies Cells of the vertebrate acquired immune system produce antibodies with an exquisite specificity for molecules Biologists use antibodies to localize.
The Enzyme Linked Immunosorbent Assay (ELISA).. Capture ELISAs Antigen Capture: In this, more specific approach, a capturing Ab is adsorbed onto the solid.
BioChip Ventures Division a 3-Dimensional Microarray Substrate.
IMMUNOLOGICAL METHODS IN DERMATOLOGY Shkilna M.I..
Antibody Production BIT 120 Chapter 12 (Part of Immunology lecture)
LABORATORY METHODS BASED ON ANTIGEN-ANTIBODY INTERACTIONS I
Proteins of Immunology
Author: Cheng-Chi Wang, Chi-Huey Wong
Enzyme linked immunosorbent assay
Date of download: 5/27/2016 Copyright © The American College of Cardiology. All rights reserved. From: Persistent Activation of Nuclear Factor Kappa-B.
Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.
Diagnostic immunology
Date of download: 6/22/2016 Copyright © 2016 American Medical Association. All rights reserved. From: β-Secretase Protein and Activity Are Increased in.
Telephone    Provider of Global Contract Research Services Accelerating Preclinical Research, Drug Discovery.
© 2004 Wadsworth – Thomson Learning Chapter 19 Diagnostic Immunology.
The ELISA Test What is it used for? How does it work?
ELISA BASICS.
ELISA (Enzyme-Linked Immunosorbent Assay)
Altered Secretory Activity of APE1/Ref-1 D148E Variants Identified in Human Patients With Bladder Cancer Yu Ran Lee 1,2,*, Jae Sung Lim 3,*, Ju Hyun Shin.
MONOCLONAL ANTIBODIES What are they? How are they produced? What potential uses?
Enzyme-linked immunosorbent assay (ELISA)
Lab # 6 ELISA Enzyme – Linked Immuno Sorbent Assay.
ELISPOT Assay: Cytokine
Enzyme Linked Immunosorbent Assay
ELISA for mAb detection and Quantification
Fig. 1. Antiinflammatory effects of CTRP-3 on the proinflammatory activation of adipocytes. Differentiated 3T3-L1 adipocytes (n = 9) were used for each.
Enzyme-Linked Immunosorbent Assay [ELISA]
Immunological Pregnancy Testing
Human renal epithelial cells produce the long pentraxin PTX3
Volume 61, Issue 5, Pages (May 2002)
17β-estradiol, Progesterone, and Dihydrotestosterone Suppress the Growth of Human Melanoma by Inhibiting Interleukin-8 Production  Naoko Kanda, Shinichi.
Volume 70, Issue 12, Pages (December 2006)
Identification of novel IgGs in alpaca serum.
Volume 57, Issue 2, Pages (October 2000)
Volume 133, Issue 3, Pages (September 2007)
Enzyme Linked  Immuno sorbent  Assay  
Volume 22, Issue 1, Pages (January 2005)
Volume 56, Issue 1, Pages (July 1999)
Interleukin-17 is Produced by Both Th1 and Th2 Lymphocytes, and Modulates Interferon-γ- and Interleukin-4-Induced Activation of Human Keratinocytes  Cristina.
Presentation transcript:

The Detection of expressed IL-32 in the Human Stomach Cancer using an ELISA and Immunostaining. Seo, Eun-Hee October 6, 2008 Lab of Cell Biol& ImmunoBiochem Department of Bioscience & Biotechnology Konkuk University, Seoul, Korea

Introduction of IL-32 Summary Material & Method C ontents Purpose Evaluation of IL-32 ELISA

Interleukin-32 Proinflammatory cytokine In activated T cells, NK-cells, monocytes, epithelial cells Human chromosome 16p13.3 Eight small exons & Six splice variants ( IL-32α / β / γ / δ / ε and ζ ) Inducer of TNF- α, IL-1β, MIP-2, IL-8 Trigger of the IκB/NF- κB cascade, p38 MAPK Autoimmunity Reviews 6 (2007) 131–137 Ann Rheum Dis 2006;65(Suppl III):iii61–iii64. IL-32 promotes a number of proinflammatory cytokines.

Purpose Preparation of monoclonal antibodies reactive to IL-32 Evaluation of sandwich ELISA base on the combination of various antibody pairs Determination of IL-32 level in the sera of cancer patients Detection of intact IL-32 level in mammalian cells

Antibody purification KU32-07 ; IL-32α KU32-52 ; IL-32α β γ δ KU32-56 ; IL-32α β KU32-09 ; IL-32α β γ δ Affinity column (Protein A/G agarose) “ Hybridoma cell ” Antibody B-cell Myeloma cell Stimulation of B-cell Hybridoma screening Material & Method

Antigen; IL-32α (yeast) [ Lane ] 1. Extract of yeast expressed IL KU32-52 Affinity bead (Ne control) 3. IL-32 bound to KU32-52 Affinity bead 4. Eluant 5. Eluted KU32-52 Affinity bead 72kD 55kD 40kD 33kD 24kD 17kD Extract of yeast expressed IL-32 KU32-52 Affinity bead IL-32α (20kDa)

Sandwich ELISA The ELISA (Enzyme-Linked ImmunoSorbent Assay) can be used both qualitatively and quantitatively to measure antigen-antibody binding. Depending on what variation you use, it will detect antigen (hormones, enzymes, microbial antigens) or antibody in body fluids or tissue culture supernatents. The Sandwich ELISA measures the amount of antigen between two layers of antibodies. Sandwich ELISAs are especially valuable when the concentration of antigens is low and/or they are contained in high concentrations of contaminating protein. Detection Antibody TMB Capture Antibody HRP HRP-linked Antibody

(A) Negative isotype control mouse IgG1 antibody (B) KU32-09 ( IgG1) (400X) Fig. 1] Representative immunohistochemical staining of IL-32 in stomach cancers. Result

Empty vector IL-32αIL-32ß IL-32 (pg/ml) 56 kD 40 kD 33 kD 24 kD 17 kD IL-32α IL-32β Empty vector K-562 (A) Fig. 2] Detection of expressed or secreted IL-32 from the stable K-562 transfectants expressing IL-32α or β. (B)

Dilution linearity of hIL-32α ELISA hIL-32α ELISA using PoAb and biotinylated KU32-52 Standard curve y = x IL-32 alpha (pg/ml) O.D A Observed Value IL-32 alpha (pg/ml) y = x R 2 = Theoretical Value IL-32 alpha (pg/ml) B Fig. 3] ELISA for IL-32 using a coating polyclonal Ab and a capturing biotinylated mAb KU32-52.

A) Run to run precision ControlNXSD%CVRecovery (%) IL-32α (pg/ml) Low (250 pg/ml) Medium (1000 pg/ml) High (2500 pg/ml) B) Within run precision ControlNXSD%CVRecovery (%) IL-32α (pg/ml) Low (250 pg/ml) Medium (1000 pg/ml) High (2500 pg/ml) C) Dilution linearity Dilution factorExpected (pg/ml)Observed (pg/ml)Recovery (%)

D) Cross-reaction of monoclonal antibody for hIL-32α and the related cytokines CytokinesCross-reaction (%) hIL-32α100 hIL-32β100 hIL-1α< 0.1 hIL-1β< 0.1 hIL-2< 0.1 hIL-6< 0.1 hIL-8< 0.1 hIL-10< 0.1 hIL-18< 0.1 hTNF-α< 0.1 Table 1] Evaluation of ELISA for hIL-32 using a polyclonal anti-hIL-32 antibody and a biotinylated mAb KU32-52 as a coating and a capturing antibody, respectively.

IL-32 ELISA NormalTumors IL-32 (pg/mL) X=186.3 %CV=55.5 X=119.9 %CV=18.8 n=10 n=16 Fig. 4] IL-32 protein levels in the plasma of stomach cancer patients and healthy individuals.

Summary A new cytokine, IL-32 usually exerts a role inside the cells and less amount of IL-32 would be secreted from the cells. The established sandwich ELISA can sensitively and specifically detect 100 pg/ml of IL-32 alpha. but not other cytokines. The mAb, KU32-52, can be effectively used in the functional study of IL-32 in the pathogenesis of cancer and inflammatory diseases. This immunoassay and immunohistochemistry can be used in the detection of expressed and secreted IL-32 in stomach cancer patients. The mAb, KU32-09, was shown to react strongly on immunohistochemistry in the tissues of stomach cancer.

THANK YOU