Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS 279.48 (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.

Slides:

Advertisements

Similar presentations

Chapter 20 Cladograms.

Advertisements

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.

Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,

Reading Phylogenetic Trees

Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.

MB-PO13 T S. graminisoli NBRC T S. shenzhenensis DSM T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.

Choosing the most parsimonious tree

 Organisms are grouped into clades  A clade is a group of species that includes an ancestral species and all of its descendants  Based on a new trait.

Supplemental Fig. S1. Orange- and yellow-flowered cultivars of calendula used in this study. Alice OrangeOrange StarPompom OrangeOrange Gem Alice YellowGold.

From: On the Origin of Darwin's Finches

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Sierra M. Love Stowell & Andrew P. Martin Student Figures

LSJ3 TH1 CBS BC7 BC4 AB1 AB2 LSJ1 TH2 SO1 SO6 LEC1 LEC2 ONT6

Evaluation of bacterial and fungal isolates efficient for controlling Gnomoniopsis smithogilvyi, the agent of chestnut fruit rot and chestnut canker Matteo.

CYB561 mutations. CYB561 mutations. The upper part shows the structure of the CYB561 gene, with the positions of the identified mutations indicated. Gray.

Using Bioinformatics to Study Evolutionary Relationships

gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)

Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar.

Anti-CD40 and CpG induce activation of T cells in draining lymph nodes

O. Barraud, M. Casellas, C. Dagot, M.-C. Ploy

WPV1 complete VP1 gene phylogeny including the RC2010 viruses.

Zika virus genome from the Americas

Schematic representation of the MAT loci of S. pombe, P. jirovecii, P

3-I 3 3-II Farm S1-25f swine (AY858911) Mexico

Chapter 20 Phylogenetic Trees. Chapter 20 Phylogenetic Trees.

F. Magurano Clinical Microbiology and Infection

Hierarchical cluster analysis of reproducible parent masses (MS) representative of produced SMs from oral in vitro-grown biofilm representing >100 bacterial.

Ehrlichia canis phylogenetic analysis of the Borgo (Corsica) strain

A. Papa, K. Xanthopoulou, S. Gewehr, S. Mourelatos

Amino acid alignment of TprK showing six different sequences in the T

Phylogenetic tree of perA A2-domain DNA sequence.

Phylogenetic tree of genome-sequenced bacterial strains from the Populus microbiome. Phylogenetic tree of genome-sequenced bacterial strains from the Populus.

Phylogeny of Shiga toxin-encoding phage from SDi/SJo S. sonnei isolates. Phylogeny of Shiga toxin-encoding phage from SDi/SJo S. sonnei isolates. (A) progressiveMauve.

Fig. 2 Identification of the candidate AvrSr35 gene.

Rapid identification of clinical Trichoderma longibrachiatum isolates by cellulose-acetate electrophoresis-mediated isoenzyme analysis A. Szekeres, M.

Development of a real-time PCR assay for the specific detection and identification of Streptococcus pseudopneumoniae using the recA gene V. Sistek, M.

Maximum likelihood (ML) unrooted tree based on the full-length 16S rRNA genes (A) and 31 conserved single-copy genes (B) showing the phylogenetic position.

(A, left) Radial cladogram based on RAxML-based maximum-likelihood phylogeny (500 bootstraps, gamma distribution model, and LG+F substitution model) constructed.

Emergence of Crimean–Congo haemorrhagic fever in Greece

Phylogenetic tree of 38 Pseudomonas type strains, based on the V3-V5 region sequence of the 16S rRNA gene (V3 primer, positions 442 to 492; and V5 primer,

Mammalian phylogeny: Genes and supertrees

Species diversity within the P. fluorescens species complex.

Reconstructing the Evolution of Laughter in Great Apes and Humans

Successful spread and transmission of rifampin-resistant clones.

Cetaceans on a Molecular Fast Track to Ultrasonic Hearing

Phylogenetic Trees Jasmin sutkovic.

Fungi most closely related to A. gossypii.

Maximum likelihood phylogeny of USA500 and other CC8 strains.

But what if there is a large amount of homoplasy in the data?

T. A. Nguyen, L. P. Hoang, L. D. Pham, K. T. Hoang, S. Okitsu, M

Visualization of lineage radius increase.

bHLH-PAS protein family structure and phylogeny.

Spiral wave initiation due to a FPR in a 2D medium.

Genomic phylogeny reveals the long-term coexistence of diverse clades.

Rooted neighbor-joining tree inferred from the concatenated MLST typing scheme sequences (CAP59, GPD1, LAC1, SOD1, URA5, and PLB1 genes and IGS) of 10.

Phylogenetic tree of 38 Pseudomonas type strains, based on a concatenated nine-gene MLST analysis. Phylogenetic tree of 38 Pseudomonas type strains, based.

The Bov-A2 element is conserved in the NOS2 gene of bovid species.

Unrooted neighbour-joining phylogenetic tree based on the 5′UTR (5′ untranslated region) sequence among pestiviruses. Unrooted neighbour-joining phylogenetic.

Novel West Nile virus lineage 1a full genome sequences from human cases of infection in north-eastern Italy, 2011 L. Barzon Clinical Microbiology and.

Fig. 3 Classification of gene essentiality by transposon mutagenesis.

Fig. 3 Phylogenetic pattern of NFN symbiosis–related genes.

Distance tree of ITS2 rRNA gene sequences of 54 strains belonging to species known as black-grain mycetoma agents. Distance tree of ITS2 rRNA gene sequences.

Views of Animal Phylogeny

Phylogenetic tree based on predominant 16S rRNA gene sequences obtained by C4–V8 Sutterella PCR from AUT-GI patients, Sutterella species isolates, and.

Phylogenetic tree of Shigella, EIEC, and nonpathogenic E

Relationship of partial rpoB gene sequences inferred by the neighbor-joining method for Canadian study strains of C. pyruviciproducens. Relationship of.

16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts. 16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts.

ADAGE extracted features that represented sequence differences between strains. ADAGE extracted features that represented sequence differences between.

Fig. 3 Gene flow signals for baleen whales inferred by the D statistic, DFOIL, and PhyloNet. Gene flow signals for baleen whales inferred by the D statistic,

Presentation transcript:

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina GJS (DQ835424) H. sulphurea GJS (DQ835425) H. victoriensis GJS (EU330952) H. lactea GJS (DQ000624) H. citrina CBS T (DQ835417) H. pseudostraminea GJS sensu Overton et al. 2006a (DQ835419) H. americana GJS (DQ835410) H. pulvinata GJS (DQ835409) H. protopulvinata CBS (DQ835405) TUFC TUFC TUFC TUFC TUFC T. brevicompactum CBS (EU330942) H. melanomagna GJS (AY737770) H. lutea CBS (AY737773) H. luteocrystallina CBS (FJ860774) H. decipiens GJS (EF558546) T. pseudostramineum TUFC (JQ797393) T. longibrachiatum DAOM ( EU330961) T. citrinoviride DAOM (EU330960) H. pseudokoningii DAOM T (EU280097) T. lieckfeldtiae CBS T (DQ109529) T. theobromicola CBS T (DQ109525) T. asperellum GJS 90-7 (EU330956) H. flaviconidia GJS (DQ023301) H. pezizoides GJS (DQ000632) TUFC T. pubescens DAOM T (EU280121) T. hamatum DAOM (Z48816) T. evansii CBS T (EU883568) T. atroviride CBS (AF456917) T. koningiopsis TUFC (=CBS ) T. rogersonii GJS (DQ333550) H. stilbohypoxyli CBS T (DQ109533) T. koningiopsis TUFC T. koningiopsis DAOM (AY380901) H. rufa CBS (X93979) T. viridescens CBS (DQ315441) H. koningii CBS (DQ323409) H. phyllostachydis CBS (EU330959) T. stromaticum CCRC33614 (AF414337) H. cinnamomea CBS T (AY737759) H. catoptron CBS (AY737766) T. aggressivum DAOM (AF057600) T. harzianum CBS T (AY605713) T. pseudogelatinosum TUFC T (JQ797389) H. parmastoi TFC T (FJ860805) H. leucopus CBS (FJ860765) H. nigrovirens CBS T (AY737777) H. gelatinosa GJS (AY737775) H. tremelloides CBS (FJ860861) H. subalpina CPK 312 (FJ860851) H. aureoviridis CCRC33594 (AF414326) H. peltata GJS (HM466663) H. ceramica CBS T (AY737764) T. strictipile TUFC H. strictipilosa CPK3135 (FJ860850) T. fertile DAOM T (DQ083018) T. strictipile DAOM (FJ442219) T. spirale DAOM T (EU280068) T. virens GJS (DQ083023) H. cuneispora CBS T (AY737763) T. longipile DAOM T (AY865630) H. chlorospora GJS 98-1 (AY737762) T. mienum TUFC T (JQ621972) H. semiorbis DAOM (AY737758) T. oblongisporum DAOM (DQ083020) H. pilulifera CBS (Z48813) H. pachybasioides KRCF347 (AB298695) H. minutispora DAOM (DQ083015) ITS region 74 taxa 542 characters 130 parsimony- informative 27 trees 626 steps CI = RI = HI = Hamatum clade Hypocreanum clade Fig. S1 One of 27 most parsimonious trees inferred from a heuristic analysis of ITS sequences. Broad black and gray branches indicate PP>0.95 and % are shown above or below branches. TUFC strains are named in bold. Nectria cinnabarina CBS (AF163025) was used as the outgroup

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 1 changes T. longibrachiatum TUFC (=CBS ) T T. citrinoviride TUFC TUFC TUFC T. pleuroticola GJS (JN133598) H. tawa GJS (FJ442570) H. lixii GJS T (FJ442533) T. spirale DAOM (FJ442818) T. spirale CBS (FJ442552) T. mienum TUFC T T. flavofuscum DAOM (FJ442587) H. virens GJS (FJ442589) H. longipilosa DAOM (JN133592) H. chlorospora GJS 98-1 (FJ442559) T. thelephoricola GJS (JN133611) H. strictipilosa DAOM (FJ442586) T. strictipile TUFC H. catoptron GJS (FJ442584) H. estonica GJS (JN133589) T. strigosum GJS (EU856278) T. paucisporum GJS (DQ111956) T. theobromicola CBS (DQ111955) T. asperellum GJS (EU856271) T. evansii CBS T (EU883564) T. pubescens DAOM T (DQ111961) T. pubescens GJS (EU856249) TUFC T. lieckfeldtiae GJS T (DQ111959) H. flaviconidia GJS (DQ111960) T. hamatum GJS (EU856250) T. hamatum DAOM T (DQ111962) T. austrokoningii GJS T (DQ367717) T. viridescens GJS (DQ111965) T. viride ATCC (DQ111970) H. rogersonii GJS T (DQ333567) H. stilbohypoxyli CBS T (DQ111967) H. koningii GJS T (DQ341180) T. koningiopsis GJS T (DQ381954) T. intricatum GJS T (AY376684) T.ovalisporum DIS 70a T (AY376671) T. dingleyae GJS T (DQ367718) H. petersenii GJS T (DQ333570) T. caribbaeum GJS 97-3 T (DQ328607) T. taiwanense GJS T (DQ323455) T. dorotheae GJS T (DQ323454) T. caribbaeum var. aeqatoriale DIS 320c T (DQ328610) act gene 46 taxa 429 characters 38 parsimony- informative 392 trees 112 steps CI = RI = HI = Fig. S2. One of 392 most parsimonious trees from a heuristic analysis of the act gene. Broad black and gray branches indicate PP>0.95 and % are shown at nodes. The TUFC strains are named in bold. Trichoderma longibrachiatum TUFC was used as the outgroup

Trichoderma eijii sp. nov. 10 changes H. orientalis GJS T (EU401500) H. virens GJS (HQ342488) H. brunneoviridis CBS T (EU498340) H. brunneoviridis CBS (EU498341) H. epimyces CBS T (EU498343) H. alni CBS T (EU498337) T. inhamatum CBS T (AF399271) H. lixii CBS T (FJ623107) T. barbatum DAOM (HQ342484) T. floccosum GJS T (HQ342478) T. ivoriense GJS T (HQ342477) T. vermipilum PPRI 3559 T (HQ342479) T. lanuginosum GJS T (HQ342481) T. stromaticum GJS T (HQ342440) T. medusae GJS T (HQ342474) T. caesareum GJS T (HQ342476) T. mienum TUFC T H. stellata GJS (AY240222) H. pilulifera CBS T (AF486003) H. pachybasioides GJS (AY240215) H. pachybasioides GJS (AY240220) H. alutacea CBS (FJ179584) H. leucopus CBS (FJ179588) H. nybergiana CBS (FJ179592) H. seppoi CBS T (FJ179597) H. lacuwombatensis GJS (AY240228) H. minutispora CBS (AY240223) H. minutispora CBS (FJ179591) H. rufa CBS (AY665591) T. atroviride DAOM (AF188920) T. atroviride DAOM (AF188921) T. pubescens CBS (AY665712) T. hamatum Tam-61 (Z71415) T. hamatum LU593 (AY258898) TUFC H. flaviconidia GJS (AY665692) H. flaviconidia GJS (AY665691) chi18-5 gene 37 taxa 496 characters 181 parsimony- informative 3 trees 652 steps CI = RI = HI = Hamatum clade Fig. S3. One of 392 most parsimonious trees from a heuristic analysis of the act gene. Broad black and gray branches indicate PP>0.95 and % are shown at nodes. The TUFC strains are named in bold. Trichoderma longibrachiatum TUFC was used as the outgroup

b T. eijii sp. nov. TUFC d 5 d 7 d 9 d 9 d, rev. 20 ℃ 25 ℃ 30 ℃ c T. pseudolacteum sp. nov. TUFC ℃ 25 ℃ 30 ℃ 3 d 5 d 7 d 9 d 9 d, rev. a Lentinula edodes strain A817 3 d 5 d 7 d 9 d 20 ℃ 25 ℃ 30 ℃ 25 ℃ 10 d [controls of competition test at the different temperatures (9 cm diam Peri dish)] Fig. S4. a Lentinula edodes (strain A817) were incubated on PDA at 25 °C after 10 days, and then they were incubated on three different temperatures (20, 25 and 30 °C). b, c Competition test between L. edodes (strain A817) and Trichoderma species on PDA medium at different temperatures (20, 25 and 25 °C).