Journal of Microbiology, Immunology and Infection

Slides:

Advertisements

Similar presentations

Escherichia coli sequence type 73 as a cause of community acquired urinary tract infection in men and women in Rio de Janeiro, Brazil Ana Paula de Souza.

Advertisements

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

IL-6 significantly correlates with p-STAT3 expression and presents high variceal bleeding with mortality in cirrhotic patients: A cross-sectional study

Journal of Microbiology, Immunology and Infection

Treatment options for HUS secondary to Escherichia coli O157:H7

Molecular characterization of dengue virus 1 from autochthonous dengue fever cases in Croatia I.C. Kurolt, L. Betica-Radić, O. Daković-Rode, L. Franco,

Rapidly progressive glomerulonephritis due to coexistent anti-glomerular basement membrane and anti-myeloperoxidase antibody Chung-Yi Cheng, Tso-Hsiao.

Cholesterol glucosylation by Helicobacter pylori delays internalization and arrests phagosome maturation in macrophages Shin-Yi Du, Hung-Jung Wang, Hsin-Hung.

Novel Functional Single Nucleotide Polymorphisms in the Latent Transforming Growth Factor-β Binding Protein-1L Promoter Tomomi Higashi, Satoru Kyo, Masaki.

The Frequency of Immunoglobulin Heavy Chain Gene and T-Cell Receptor γ-Chain Gene Rearrangements and Epstein-Barr Virus in ALK+ and ALK− Anaplastic Large.

Membrane-Tethered Intracellular Domain of Amphiregulin Promotes Keratinocyte Proliferation Stefan W. Stoll, Philip E. Stuart, Sylviane Lambert, Alberto.

A.K. Reddy, P. Garg, I. Kaur Clinical Microbiology and Infection

O. Barraud, M. Casellas, C. Dagot, M.-C. Ploy

Lucia Elena Alvarado Arnez, BS, Evaristo N

Mutation of a Nuclear Respiratory Factor 2 Binding Site in the 5′ Untranslated Region of the ADSL Gene in Three Patients with Adenylosuccinate Lyase Deficiency

Development of 16S rRNA-based probes for the identification of Gram-positive anaerobic cocci isolated from human clinical specimens A.C.M. Wildeboer-Veloo,

IFN-γ Upregulates Expression of the Mouse Complement C1rA Gene in Keratinocytes via IFN-Regulatory Factor-1 Sung June Byun, Ik-Soo Jeon, Hyangkyu Lee,

Genome sequencing and characterization of an extensively drug-resistant sequence type 111 serotype O12 hospital outbreak strain of Pseudomonas aeruginosa

Molecular characterization and phylogeny of Shiga toxin–producing Escherichia coli isolates obtained from two Dutch regions using whole genome sequencing

Brenton T. Tan, Roger A. Warnke, Daniel A. Arber

Psoriasis Upregulated Phorbolin-1 Shares Structural but not Functional Similarity to the mRNA-Editing Protein Apobec-1 Peder Madsen, Julio E. Celis,

E. Tortoli, P. G. Rogasi, E. Fantoni, C. Beltrami, A. De Francisci, A

L. Dubourg Clinical Microbiology and Infection

A. Papa, K. Dumaidi, F. Franzidou, A. Antoniadis

Superoxide enhances interleukin 1β–mediated transcription of the hepatocyte-inducible nitric oxide synthase gene Paul C. Kuo, Keith Abe, Rebecca A. Schroeder

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Male patient with acute hepatitis E in Genoa, Italy: figatelli (pork liver sausage) as probable source of the infection A.R. Garbuglia, A.I. Alessandrini,

Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China J. Sun, M. Zhou, Q. Wu, Y.

Hepatitis E virus as a newly identified cause of acute viral hepatitis during human immunodeficiency virus infection P. Colson, C. Dhiver, R. Gérolami

Treatment options for HUS secondary to Escherichia coli O157:H7

Candidate Functional Promoter Variant in the FOXD3 Melanoblast Developmental Regulator Gene in Autosomal Dominant Vitiligo Asem Alkhateeb, Pamela R.

PCB126 induces apoptosis of chondrocytes via ROS-dependent pathways

A novel phlebovirus in Albanian sandflies

C. Héritier, L. Poirel, P. Nordmann

A. Papa, K. Xanthopoulou, S. Gewehr, S. Mourelatos

Comparative phylogenetic analysis of sapoviruses based on complete RdRp and VP1 nucleotide sequences. Comparative phylogenetic analysis of sapoviruses.

The oral cavity as a natural reservoir for Streptococcus sinensis

Phylogeny of Shiga toxin-encoding phage from SDi/SJo S. sonnei isolates. Phylogeny of Shiga toxin-encoding phage from SDi/SJo S. sonnei isolates. (A) progressiveMauve.

Whole genome-based phylogenetic analysis of Rickettsiae

Tracing the Evolution of Hepatitis C Virus in the United States, Japan, and Egypt By Using the Molecular Clock Masashi Mizokami, Yasuhito Tanaka Clinical.

Hepatitis B virus in Buenos Aires, Argentina: genotypes, virological characteristics and clinical outcomes S.C. Pezzano, C. Torres, H.A. Fainboim, M.B.

Development of a real-time PCR assay for the specific detection and identification of Streptococcus pseudopneumoniae using the recA gene V. Sistek, M.

The mosaic genome structure and phylogeny of Shiga toxin-producing Escherichia coli O104:H4 is driven by short-term adaptation K. Zhou, M. Ferdous, R.F.

Molecular characterization of dengue virus 1 from autochthonous dengue fever cases in Croatia I.C. Kurolt, L. Betica-Radić, O. Daković-Rode, L. Franco,

Outbreak of hand, foot and mouth disease/herpangina associated with coxsackievirus A6 and A10 infections in 2010, France: a large citywide, prospective.

Bufavirus genotype 3 in Turkish children with severe diarrhoea

Sequence Type ST131 and ST10 Complex (ST617) predominant among CTX-M-15- producing Escherichia coli isolates from Nigeria* I. Aibinu, T. Odugbemi, W.

Michael D. Howell, Joanne E. Streib, Byung Eui Kim, Leighann J

Gα-Mediated Inhibition of Developmental Signal Response

Human isolates of Aeromonas possess Shiga toxin genes (stx1 and stx2) highly similar to the most virulent gene variants of Escherichia coli A. Alperi,

Prevalence of Shiga toxin-producing Shigella species isolated from French travellers returning from the Caribbean: an emerging pathogen with international.

N. Santos, G. S. Mendes, R. C. Silva, G. A. Pena, M. Rojas, A. R

Association of the blaCMY-10 gene with a novel complex class 1 integron carrying an ISCR1 element in clinical isolates from Korea J.S. Song, S.J. Jang,

Targeted Genome Editing in Genes and cis-Regulatory Regions Improves Qualitative and Quantitative Traits in Crops Xitao Li, Yongyao Xie, Qinlong Zhu,

Human metapneumovirus-associated respiratory tract infections in the Republic of Ireland during the influenza season of 2003–2004 M.J. Carr, G.P. McCormack,

Molecular epidemiology and genetic diversity of human astrovirus in South Korea from 2002 to 2007 A.Y. Jeong, H.S. Jeong, M.Y. Jo, S.Y. Jung, M.S. Lee,

The CMK-1 CaMKI and the TAX-4 Cyclic Nucleotide-Gated Channel Regulate Thermosensory Neuron Gene Expression and Function in C. elegans John S. Satterlee,

K. S. Ko, T. Kuwahara, L. Haehwa, Y. -J. Yoon, B. -J. Kim, K. -H

M. Biçmen, Z. Gülay, S.V. Ramaswamy, D.M. Musher, D. Gür

L. Zhang, D. Raoult, P.-E. Fournier

Sandfly fever virus outbreak in Cyprus

Neighbor-joining tree based on nifH for 20 organisms along with the maximum-likelihood sequence obtained from aligning the soil data to the gene sequence.

The Bov-A2 element is conserved in the NOS2 gene of bovid species.

Actinotignum schaalii (formerly Actinobaculum schaalii): a newly recognized pathogen— review of the literature R. Lotte, L. Lotte, R. Ruimy Clinical.

Volume 70, Issue 5, Pages (May 2019)

Molecular characterization and phylogeny of Shiga toxin–producing Escherichia coli isolates obtained from two Dutch regions using whole genome sequencing

Genogroup and genotypes of GI, GII, GIII, GIV, and GV sapovirus strains based on complete VP1 nucleotide sequences. Genogroup and genotypes of GI, GII,

Phylogenetic tree based on predominant 16S rRNA gene sequences obtained by C4–V8 Sutterella PCR from AUT-GI patients, Sutterella species isolates, and.

Evidence for a Far East Asian origin of lager beer yeast

Volume 110, Issue 5, Pages (September 2002)

Presentation transcript:

Journal of Microbiology, Immunology and Infection Regulatory elements of stx2 gene and the expression level of Shiga-like toxin 2 in Escherichia coli O157:H7 I Wayan Suardana, Komang Januartha Putra Pinatih, Dyah Ayu Widiasih, Wayan Tunas Artama, Widya Asmara, Budi Setiadi Daryono Journal of Microbiology, Immunology and Infection DOI: 10.1016/j.jmii.2016.04.006 Copyright © 2016 Terms and Conditions

Figure 1 Phylogenetic tree was constructed using the neighbor-joining algorithm of open reading frame of stx2 gene (1241 bp). The number in the branch of the phylogram indicates bootstrap value (%) by 1000-replication multiple, and the scale indicates two per 1000 substitutions of the nucleotide sequence of stx2 gene. E. coli = Escherichia coli. Journal of Microbiology, Immunology and Infection DOI: (10.1016/j.jmii.2016.04.006) Copyright © 2016 Terms and Conditions

Figure 2 Comparison of the nucleotide sequence of the promoter region and ribosome binding site among stx2 genes of Enterobacteria phage 933W, Escherichia coli ATCC 43894, KL-48(2) human, SM25(1) cattle, and E. coli Thai-12. Position of start codon, ribosome binding site, and −10 and −35 promoter regions are indicated by underlines. The hyphen and the asterisk indicate identical base and absence of base, respectively. Journal of Microbiology, Immunology and Infection DOI: (10.1016/j.jmii.2016.04.006) Copyright © 2016 Terms and Conditions

Figure 3 The viability and proliferation of vero cell after MTT cell proliferation assay 48 hours postinduction. Images taken with a phase contrast microscope (Olympus, Shinjukuku, Tokyo, Japan, type IMT-2/605029) with a magnification of 10 × 40. The arrow shows the stained living cells. (A, A1) non–toxin-induced cells; (B) cells induced by Escherichia coli ATCC 43894 toxin as a positive control; (C) cells induced by KL-48(2) toxin; (D) cells induced by SM-25(1) toxin; (E) cells induced by DS-16(2) toxin as a negative control. Journal of Microbiology, Immunology and Infection DOI: (10.1016/j.jmii.2016.04.006) Copyright © 2016 Terms and Conditions