A B C J K L CdFOMT1 CdFOMT3 CdFOMT4 CdFOMT5 1 kbp * * * *

Slides:



Advertisements
Similar presentations
Supplementary Table 1. Purification of Chi-V from E. coli Step Protein Activity Specific activity Yield (mg) (mmol/min) (mmol/min/mg) (%) Crude extract.
Advertisements

Figure S1 Figure S1. Effect of MeJA on spore germination of M. oryzae. The data presented were the means (± standard error) of spore germination from three.
Supplementary Fig. S2 Elution profiles of amino acid derivatives in a UPLC system. The enzyme (1 μg) was incubated with 10 mM D -amino acid (2.5 mM D -Tyr)
Louis et al. Figure S1 Mean expression intensity Figure S1. MPL1 expression in Arabidopsis organs The Genevestigator tool (
Date of download: 5/28/2016 Copyright © 2016 American Medical Association. All rights reserved. From: Increased BDNF Promoter Methylation in the Wernicke.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Enzymes Worksheet catalyst amino acids different function
From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins
Fig. 6. Characterization of the VvgGT protein product (p-hydroxybenzoyl-glucose) with p-hydroxybenzoic acid as substrate. (A) Chromatogram at 280 nm of.
Proteins enriched in HCs are strongly associated with genetic hearing/balance impairment. Proteins enriched in HCs are strongly associated with genetic.
Volume 9, Issue 11, Pages (November 2001)
The radical mechanism of biological methane synthesis by methyl-coenzyme M reductase by Thanyaporn Wongnate, Dariusz Sliwa, Bojana Ginovska, Dayle Smith,
Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.
Volume 21, Issue 2, Pages (February 2014)
(a) NP-HPLC analysis of 2-AB labelled glycans released from purified AtaC which was co-expressed with NGT and α6GlcT in E. coli DH10β (black). (a) NP-HPLC.
Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.
Structural and Functional Studies of the Mitochondrial Cysteine Desulfurase from Arabidopsis thaliana  Valeria R. Turowski, Maria V. Busi, Diego F. Gomez-Casati 
A Proteolytic Cascade of Kallikreins in the Stratum Corneum
Volume 3, Issue 5, Pages (October 1998)
Solution Structure of the U11-48K CHHC Zinc-Finger Domain that Specifically Binds the 5′ Splice Site of U12-Type Introns  Henning Tidow, Antonina Andreeva,
An FAD-Dependent Pyridine Nucleotide-Disulfide Oxidoreductase Is Involved in Disulfide Bond Formation in FK228 Anticancer Depsipeptide  Cheng Wang, Shane.
Volume 84, Issue 3, Pages (February 1996)
Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.
Volume 11, Issue 1, Pages (January 2003)
Interaction with PCNA Is Essential for Yeast DNA Polymerase η Function
Kevin J. Forsberg, Sanket Patel, Timothy A. Wencewicz, Gautam Dantas 
Volume 91, Issue 4, Pages (November 1997)
Volume 18, Issue 6, Pages (June 2011)
Volume 85, Issue 4, Pages (October 2003)
Joshua C. Black, Capucine Van Rechem, Johnathan R. Whetstine 
De Novo Mutations in the Sodium-Channel Gene SCN1A Cause Severe Myoclonic Epilepsy of Infancy  Lieve Claes, Jurgen Del-Favero, Berten Ceulemans, Lieven.
Volume 11, Issue 1, Pages (January 2018)
Volume 95, Issue 5, Pages (November 1998)
A Nonsense Mutation in CRYBB1 Associated with Autosomal Dominant Cataract Linked to Human Chromosome 22q  Donna S. Mackay, Olivera B. Boskovska, Harry.
ClpS, a Substrate Modulator of the ClpAP Machine
Volume 11, Issue 1, Pages (January 2018)
Keehwan Kwon, Yu Lin Jiang, James T. Stivers  Chemistry & Biology 
Terence S. Crofts, Erica C. Seth, Amrita B. Hazra, Michiko E. Taga 
Volume 2, Issue 1, Pages (January 2009)
Validation of ChIP-seq reads.
Volume 23, Issue 4, Pages (August 2006)
Exon Junction Sequences as Cryptic Splice Sites
Volume 7, Issue 10, Pages (October 2000)
Subnetworks enriched for the hallmarks of cancer.
Localization of the Iff8 extended protein.
MYB34, MYB51, and MYB122 Distinctly Regulate Indolic Glucosinolate Biosynthesis in Arabidopsis thaliana  Frerigmann Henning , Gigolashvili Tamara   Molecular.
Nickel2+-Mediated Assembly of an RNA-Amino Acid Complex
Opitz G/BBB Syndrome in Xp22: Mutations in the MID1 Gene Cluster in the Carboxy- Terminal Domain  Karin Gaudenz, Erich Roessler, Nandita Quaderi, Brunella.
Biosynthetic Pathway Connects Cryptic Ribosomally Synthesized Posttranslationally Modified Peptide Genes with Pyrroloquinoline Alkaloids  Peter A. Jordan,
Identification of the GCS1 ortholog in Gonium pectorale.
Figure 1. Kidney-Specific Cre/loxP Recombination.
S. pneumoniae GapA is sensitive to oxygen and H2O2 exposure.
Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.
Mitochondrial enzymatic activities and root tip respiration in wild type (WT) and mab1-1. Mitochondrial enzymatic activities and root tip respiration in.
Importance of a Single Base Pair for Discrimination between Intron-Containing and Intronless Alleles by Endonuclease I-BmoI  David R. Edgell, Matthew.
Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.
Bacillus subtilis Glutamine Synthetase Controls Gene Expression through a Protein- Protein Interaction with Transcription Factor TnrA  Lewis V Wray, Jill.
Neighbor-joining tree of the 262 S
Figure 2 Compound heterozygous mutations in ADAM22
Characterization of Calcium, Nucleotide, Phosphate, and Vanadate Bound States by Derivatization of Sarcoplasmic Reticulum ATPase with ThioGlo1  Suming.
Molecular structure of MFS1 promoter genotypes.
C-Lineage-Dependent CRC Expression and Nectary Development in Arabidopsis and Petunia. C-Lineage-Dependent CRC Expression and Nectary Development in Arabidopsis.
Differential methylation at 12 selected HPV16 CpGs in cervical cells from premalignant lesions with biopsy-confirmed diagnoses from our original study.
Neurodegenerative Tauopathies
CCA1 Binds the Promoter of GI in Vitro and in Vivo.
ROS Generation, Defense Gene Expression, and Histone Acetylation Levels in the HDT701 OX and RNAi Plants.(A) ROS level in HDT701 RNAi plants after flg22.
Volume 97, Issue 6, Pages (June 1999)
Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.
Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.
Presentation transcript:

A B C J K L CdFOMT1 CdFOMT3 CdFOMT4 CdFOMT5 1 kbp * * * * Figure S1. Gene structure of CdFOMT sequences from Citrus depressa. Exons and introns are expressed as boxes and lines, respectively. Black boxes indicate conserved motifs that are involved in interactions with SAM in plant OMTs. Introns inserted into each gene, in which neighboring amino acid sequences are highly conserved across CdFOMTs, are marked with asterisks Itoh et al. Fig. S1

A) B) Figure S2. Optimum pH (A) and temperature (B) for O-methyltransferase activity of recombinant CdFOMT5. Enzyme activity was measured in the following buffers: 50 mM sodium citrate (filled diamonds), 50 mM MES (filled squares), 50 mM phosphate-KOH (filled triangles), 50 mM Tris-HCl (filled circles), and 50 mM glycine-NaOH (multiplication sign). Enzyme activity was measured for 1 h with shaking at various temperatures.   Itoh et al. Fig. S2

P1 P3 P2 UV S P4 x P1 P2 P3 P4 Figure S3. Mass spectrometry analysis of quercetin products methylated by CdFOMT5. Peak labeled with ‘x’ was not identified as flavonoid derivatives. Itoh et al. Fig. S3

Itoh et al. Fig. S4 Naringenin UV MS S S+E (-)-Epicatechin X P S X S+E Equol P1 P1 P2 S S+E P2 Figure S4. HPLC and LC-MS analysis of methylated products of various flavonoids by CdFOMT5. S, substrate control; S+E, enzyme reaction product; P, product peak. For equol, P1 and P2 indicate major and minor monomethylated products, respectively. Peaks labeled with ‘x’ were not identified as flavonoid derivatives. Itoh et al. Fig. S4