Pilot experiment – needs to be optimised

Slides:

Advertisements

Similar presentations

Antibodies Analytical Techniques Utilizing Antibodies: flow cytometry

Advertisements

Immunology: diagnosing infections. What is diagnostic immunology? Term for a variety of diagnostic techniques that rely on the specificity of the bond.

Western Blotting.

Immunology ANTIBODIES we have ~10 12 antibodies made against foreign viruses, bacteria, parasites (vaccines) antibodies combine with foreign antigens to.

Western blotting. Antibodies in the Immune System Structure: 2 heavy chains + 2 light chains Disulfide bonds 2 antigen binding sites Isotypes: IgG, IgM,

Anti-OPN Monoclonal Antibodies as Probes of OPN Structure and Function Christian C. Kazanecki, Josephine Cassella, Yao Li, Cassandra Louis, Tanya Gordonov,

Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.

Figure S1. Production of recombinant NS1 protein

GENE EXPRESSION STUDY ON PROTEIN LEVEL

department < clinical chemistry, microbiology and immunology >

RASSF2DSARAH-GF (b) MST1-F (a) M F G 70 kD a 55 kD b 36 kD

Peptide reactivity between multiple sclerosis (MS) CSF IgG and recombinant antibodies generated from clonally expanded plasma cells in MS CSF Xiaoli.

Volume 9, Issue 3, Pages (March 2004)

Connective Tissue Growth Factor (CCN2) in Rat Pancreatic Stellate Cell Function: Integrin α5β1 as a Novel CCN2 Receptor Runping Gao, David R. Brigstock

Immunological Pregnancy Testing

Transglutaminase-mediated oligomerization of the fibrin(ogen) αC domains promotes integrin-dependent cell adhesion and signaling by Alexey M. Belkin, Galina.

Nat. Rev. Neurol. doi: /nrneurol

IP-MS identifies FAM49B interacting protein Rac.

ADAP interactions with talin and kindlin promote platelet integrin αIIbβ3 activation and stable fibrinogen binding by Ana Kasirer-Friede, Jian Kang, Bryan.

Angiopoietins can directly activate endothelial cells and neutrophils to promote proinflammatory responses by Caroline Lemieux, Ricardo Maliba, Judith.

TAPP2 links phosphoinositide 3-kinase signaling to B-cell adhesion through interaction with the cytoskeletal protein utrophin: expression of a novel cell.

(A) NK cell cytotoxicity assays against K562, H9, and Raji target cell lines in the presence (black) and absence (white) of an anti-NKp30 antibody, clone.

Kre1p, the Plasma Membrane Receptor for the Yeast K1 Viral Toxin

Chronic neutropenia mediated by Fas ligand

Specific Lysis of Melanoma Cells by Receptor Grafted T Cells is Enhanced by Anti- Idiotypic Monoclonal Antibodies Directed to the scFv Domain of the Receptor

Evidence for enhanced collagen type III deposition focally in the territorial matrix of osteoarthritic hip articular cartilage S. Hosseininia, M.A. Weis,

Ho-Geun Yoon, Doug W. Chan, Albert B. Reynolds, Jun Qin, Jiemin Wong

Rose-Anne Romano, Barbara Birkaya, Satrajit Sinha

Cellular localization of the chimeric Iff5-Iff1C, Iff5-Iff2C, Iff5-Iff4C, Iff5-Iff7C, and Iff5-Iff10C proteins. Cellular localization of the chimeric Iff5-Iff1C,

Volume 25, Issue 3, Pages (March 2017)

Aimee S. Payne, Don L. Siegel, John R. Stanley

Volume 63, Issue 2, Pages (February 2003)

Volume 131, Issue 1, Pages (July 2006)

Identification of novel IgGs in alpaca serum.

Volume 9, Issue 3, Pages (March 2004)

Yang Shen, Monica Naujokas, Morag Park, Keith Ireton Cell

The PbGAPDH G6 fragment interacts with recombinant CD68.

Expression of SYCE2 inhibits the interaction of HP1α with H3K9me3.

Pathogenic Anti-Desmoglein 3 mAbs Cloned from a Paraneoplastic Pemphigus Patient by Phage Display Marwah A. Saleh, Ken Ishii, Jun Yamagami, Yuji Shirakata,

c-Src Activates Endonuclease-Mediated mRNA Decay

Aminopeptidase A: A nephritogenic target antigen of nephrotoxic serum

The Intracellular and Extracellular Domains of BP180 Antigen Comprise Novel Epitopes Targeted by Pemphigoid Gestationis Autoantibodies Giovanni Di Zenzo,

IgG Autoantibodies from Bullous Pemphigoid (BP) Patients Bind Antigenic Sites on Both the Extracellular and the Intracellular Domains of the BP Antigen.

Human monoclonal or polyclonal antibodies recognize predominantly discontinuous epitopes on bee venom phospholipase A2 Theres Schneidera, Alois B. Lang,

Volume 92, Issue 6, Pages (March 1998)

Recombinant laminins used for in vitro binding assay.

TP53 western blot of primary cultured tail cells from both wild-type (WT) and Tp53Δ11/Δ11 (−/−) rats. TP53 western blot of primary cultured tail cells.

Western blot analysis of histone H1.X.

Hypoallergenic derivatives of the major birch pollen allergen Bet v 1 obtained by rational sequence reassembly Raffaela Campana, PhD, Susanne Vrtala,

The microtubule-binding region of RECQL4 is required for chromosome alignment. The microtubule-binding region of RECQL4 is required for chromosome alignment.

Full-length TAPL interacts specifically with LAMP-1 and LAMP-2.

Volume 86, Issue 2, Pages (July 1996)

Fig. 1. p85β localizes at adhesion plaques and associates with FAK

Increased anti-DNA Abs in 2KO-Bcl6TC mice.

Volume 7, Issue 6, Pages (June 2001)

Recognition of naturally processed HTLV-1 Tax protein derived from HAM patient's PBMC. A, HTLV-1 Tax protein content was evaluated by Western blot analysis.

Key functional sites of SPINDLIN1 could be phosphorylated by Aurora-A.

B7-1 and PD-1 compete for binding to PD-L1.

Mapping the Pirh2 and p73 interaction sites.

Atsushi Yamanaka, Eiji Konishi

RTA pepscan analysis of sera from RiVax- and RVEc-immunized mice.

Dilution of anti-C6 monoclonal antibody shows the broader linear range of the Multiplex assay in comparison to standard ELISA. Shown is the dilution of.

Binding characteristics of mAbs isolated from plasmablasts during acute ZIKV infection. Binding characteristics of mAbs isolated from plasmablasts during.

Identification of the recombinant structural proteins expressed in recombinant baculovirus-infected Sf9 cells by immunofluorescence assay with rabbit anti-FMDV.

Figure 2. Histoimmunoprecipitation and antigen identification

Tumor-specific panel of mAbs are reactive with human B7-H3.

a. a. 35–47 mediate the binding of mCRP to CFH in ELISAs

MED25 and JAZ7 Compete to Interact with MYC2.

Expression of MtrE by wild-type and mtr120 mutant strains.

Fig. 5. Can f 4-specific mAbs and the sandwich ELISA for the quantification of Can f 4. (A) The epitope specificity of the three Can f 4-specific mAbs.

Presentation transcript:

Pilot experiment – needs to be optimised

PAM2.8 ? PAM6.1 ?

PAM8.1 ?

Region 1 Region 2 PAM2.8 and PAM6.1 in region 2?

Antibodies eluted from surface of recombinant DBL3 and run in pepscan Region 1 Region 2 female anti-DBL3 serum rabbit anti-DBL3 serum

mAbs Titration of all mAbs – All can be used at 1:4.000 at least

Monoclonal epitopes: -Mass Spectrometry project (SSI + DTU) 1st verify if monoclonals target denatured recombinant domais Method - Western blot 3.1 + 5.2 targetted DBL5 after denaturing protein gel Confirm by ELISA: Epitope is probably non linear. - Confirm by competition ELISA with diferent conc of denatured DBL5 competing with the mAbs.

MDKSSIANKIEAYLGAKSDDSKIDQSLKADPSEVQYYGSGGDGYYLRKNICKITVNHSDSGTNDPCDRIPPPYGDNDQWKCAIILSKVSEKPENVFVPPRRQRMCINNLEKLNVDKIRDKHAFLADVLLTARNEGERIVQNHPDTNSSNVCNALERSFADIADIIRGTDLWKGTNSNLEQNLKQMFAKIRENDKVLQDKYPKDQNYRKLREDWWNANRQKVWEVITCGARSNDLLIKRGWRTSGKSNGDNKLELCRKCGHYEEKVPTKLDYVPQFLRWLTEWIEDFYREKQNLIDDMERHREECTSEDHKSKEGTSYCSTCKDKCKKYCECVKKWKSEWENQKNKYTELYQQNKNETSQKNTSRYDDYVKDFFKKLEANYSSLENYIKGDPYFAEYATKLSFILNSSDANNPSEKIQKNNDEVCNCNESGIASVEQEQISDPSS NKTCITHSSIKANKKKVCKHVKLGVRENDKDLRVCVIEHTSLSGVENCCCQDFLRILQENCSDNKSGSSSNGSCNNKNQEACEKNLEKVLASLTNCYKCDKCKSEQSKKNNKNWIWKKSSGKEGGLQKEYANTIGLPPRTQSLCLVVCLDEKGKKTQELKNIRTNSELLKEWIIAAFHEGKNLKPSHEKKNDDNGKKLCKALEYSFADYGDLIKGTSIWDNEYTKDLELNLQLQKIFGKLFRKYIKKNNTAEQDTSYSSLDELRESWWNTNKKYIWLAMKHGAGMNSTTCCGDGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQEKVKPVIENCKSCKESGGTCNGECKTECKNKCEVYKKFIEDCKGGDGTAGSSWVKRWDQIYKRYSKYIEDAKRNRKAGTKNCGPSSTTNAAENKCVQSDIDSFFKHLIDIGLTTPSSYLSIVLDDNICGADKAPWTTYTTYTTTEKCNKETDKSKLQQCNTAVVVNVPSPLGNTPHGYKYACQCKIPTNEETCDDRKEYMNQWSCGSARTMKRGYKNDNYELCKYNGVDVKPTTVRSNSSKLDDKDVTFFNLFEQWNKEIQYQIEQYMTNTKISCNNEKNVLSRVSDEAAQPKFSDNERDRNSITHEDKNCKEKCKCYSLWIEKINDQWDKQKDNYNKFQRKQIYDANKGSQNKKVVSLSNFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKCGNDSGDGETIFSEKLNNAEKKCKENESTNNKMKSSETSCDCSEPIYIRGCQPKIYDGKIFPGKGGEKQWICKDTIIHGDTNGAGACIPPRTQNLCVGELWDKRYGGRSNIKNDTKESLKQKIKNAIQKETELLYEYHDKGTAIISRNPMKGQKEKEEKNNDSNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEYIGKLQEDIKKIIEKGTTKQNGKTVGSGAENVNAWWKGIEGEMWDAVRCAITKINKKQKKNGTFSIDECGIFPPTGNDEDQSVSWFKEWSEQFCIERLQYEKNIRDACTNNGQGDKIQGDCKRKCEEYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCEQVKYYEYNNAEKKNNKSLCHEKGNDRTWSKKYIKKLENGRTLEGVYVPPRRQQLCLYELFPIIIKNKNDITNAKKELLETLQIVAEREAYYLWKQYHAHNDTTYLAHKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNEIFDSSNKNDIETKRARTDWWENEAIAVPNITGANKSDPKTIRQLVWDAMQSGVRKAIDEEKEKKKPNENFPPCMGVQHIGIAKPQFIRWLEEWTNEFCEKYTKYFEDMKSNCNLRKGADDCDDNSNIECKKACANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCNGEINGNYICCSCKNIGENSTSGTVNKKLQKKETQCEDNKGPLDLMNKVLNKMDPKYSEHKMKCTEVYLEHVEEQLQLKEIDNAIKDYKLYP LDRCFDDKSKMKVCDLIGDAIGCKHKTKLDELDEWNDVDMRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLKEFKEEILKGAQSEGKFLGNYYNEDKDKEKALEAMKNSFYDYEYIIKGSDMLTNIQFKDIKRKLDRLLEKETNNTEKVDDWWETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTETPPQFLRWIKEWGTNVCIQKEEHKEYVKSKCSNVTNLGAQESESKNCTSEIKKYQEWSRKRSIQWEAISEGYKKYKGMDEFKNTFKNIKEPDANEPNANEYLKKHCSKCPCGFNDMQEITKYTNIGNEAFKQIKEQVDIPAELEDVIYRLKHHEYDKGNDYICNKYKNINVNMKKNNDDTWTDLVKNSSDINKGVLLPPRRKNLFLKIDESDICKYKRDPKLFKDFIYSSAISEVERLKKVYGEAKTKVVHAMKYSFADIGSIIKGDDMMENNSSDKIGKILGDGVGQNEKRKKWWDMNKYHIWESMLCGYKHAYGNISENDRKMLDIPNNDDEHQFLRWFQEWTENFCTKRNELYENMVTACNSAKCNTSNGSVDKKECTEACKNYSNFILIKKKEYQSLNSQYDMNYKETKAEKKESPEYFKDKCNGECSCLSEYFKDETRWKNPYETLDDTEVKNNCMCKPPPPASNNTSDILQKTIPFGIALALGSIAFLF

Peptide 30 - DBL3 – one of the most frequent on Phage display We also have a FCR3 variants correspondent to P30 = P32 - DBL3 binds to CSA (only the FCR3 variant) (Gamain, et al.)

Confirm binding of Var2CSA peptides to CSPG: Phage individual solutions expressing the different peptides Confirm binding with anti-phageT7 antibody Phages are not binding to the plate - precipitation and concentration of samples + Change of buffer

CSA adhesion 3d7

Protein expression 1 Placentale FCR3 HB3 Var2csa 15 stk DNA 20 stk cDNA FCR3 HB3

Chimeric protein expression

Proteins Proteins will be tested for CSA binding in ELISA Proteins will be tested for reactivity in ELISA Proteins will be used to map binding site of humAbs Proteins will be used to induce antibodies in rabbits

Rabbit antibodies Rabbit IgG will be tested for surface staining of CSA adhering parasites Rabbit IgG will be tested in antiadhesion assays