22 kDa a-coixin gene cluster

Slides:

Advertisements

Similar presentations

The Build-up of the Red Sequence at z

Advertisements

Gene Regulation: What it is, and how to detect it By Jordan, Jennifer, and Brian.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

Supplemental data 1. Correspondence between Ensembl genes and proteins accession numbers.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Figure S1. Alignment of sequences from the 5′-end to the Sm binding site of reported genomic sequences (9-15) for HSUR 1. MicroRNA binding sites are.

Supplemental Materials of Two conserved oligosaccharyltransferase catalytic subunits required for N-glycosylation exist in Spartina alterniflora Luyi Jiang.

Visualizing Biosciences Genomics & Proteomics. “Scientists Complete Rough Draft of Human Genome” - New York Times, June 26, 2000 The problem: –3 billion.

Supporting information Figures S1-S5. % Supplemental figure 1 Figure S1: Mycorrhizal colonization parameter et al 1996 Mycorrhizal colonization parameters.

C acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCATGTCTA b acaatataATGGAGCGTGAGACTTCGTCATCTTCAACTCCTCCGGAGGATCTTGTTACATCGATGATCGGAAAGTTCGTCGCTGTCTTGTCTA.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Rupp et al. Supplementary Figure 1: Structure of the human troponin T gene Exon 6 Genomic DNA cDNA from mRNA mutation Exon 9 Exon bp Parts of genomic.

Supplementary Materials

by Nancy D. Borson, Martha Q. Lacy, and Peter J. Wettstein

Fig. 7. Intrapatient variation in key contact signatures for PGDM1400 and PGT121. Intrapatient variation in key contact signatures for PGDM1400 and PGT121.

Sequence analysis of near full-size proviruses.

Strategies for annotation of a genome

Four design-build-test cycles produced JCVI-syn3.0.

HLA-Class I: Typing Theory

Figure 1. Type and distribution within KCNQ2 protein of variants in self-limiting epilepsy vs epileptic encephalopathy Type and distribution within KCNQ2.

Bacterial genomics: The controlled chaos of shifty pathogens

AGEseq: Analysis of Genome Editing by Sequencing

Structure Prediction: How good are we?

Schematic representation of the lbk gene, positions of gRNAs, and knock-in cassette. Schematic representation of the lbk gene, positions of gRNAs, and.

Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito

Fig. 1. Mutations in slpA confer Av-CD291.2 resistance.

Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2

Molecular cloning of pms916 salt hypersensitive T-DNA mutant.

Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China J. Sun, M. Zhou, Q. Wu, Y.

Structure of the GM2A Gene: Identification of an Exon 2 Nonsense Mutation and a Naturally Occurring Transcript with an In-Frame Deletion of Exon 2 Biao.

Genetic events disrupting perA.

Identification, description, and expression of E7-less STING isoforms.

Identification of essential genome features.

Schematic diagrams of genomic structure, the strategy for genomic cDNA cloning, and molecular characterization of unique features of three emergent U.S.

The Complete Genome Sequence of Escherichia coli K-12

Examples for intrachromosomal mRNA co‐regulation patches

Expression of a microRNA-Resistant Target Transgene Misrepresents the Functional Significance of the Endogenous microRNA: Target Gene Relationship Junyan.

Comparison of gene expression maps from available S

Phylogenetic tree of 38 Pseudomonas type strains, based on the V3-V5 region sequence of the 16S rRNA gene (V3 primer, positions 442 to 492; and V5 primer,

A Mutation in the Variable Repeat Region of the Aggrecan Gene (AGC1) Causes a Form of Spondyloepiphyseal Dysplasia Associated with Severe, Premature.

Complex evolutionary trajectories of sex chromosomes across bird taxa

* * * * * * * Supplemental Figure 3. GO Cellular Component Annotation Analysis of SA-Regulated Gene-Networks. We analyzed the genes in the gene-networks.

iraL shares sequence identity with iraM from E

Nucleotide sequence alignment of porA gene sequences from the examined English Neisseria gonorrhoeae porA mutants, compared to the porA sequences of previously.

Tagging of the endogenous Py03652 gene with the gfp gene in Plasmodium yoelii. Tagging of the endogenous Py03652 gene with the gfp gene in Plasmodium yoelii.

Usher Syndrome Type III: Revised Genomic Structure of the USH3 Gene and Identification of Novel Mutations Randall R. Fields, Guimei Zhou, Dali Huang,

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

Fig. 2. Validating the efficiency of smc3 MOs

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

General structure of RIFINs and STEVORs

Fig. 2. RGD and KGD motifs in N. vectensis thrombospondins

Fig. 2 Overview of transcriptional mutagenesis in yeast.

Identification of a functional domain in MKL1_S that allows specific transcriptional activity. Identification of a functional domain in MKL1_S that allows.

Genomic structure of LTBP-4 around the 3rd 8-Cys repeat.

Amplicon sequencing analysis of on-target sites in trβ crispants

Phylogenetic tree of K. variicola from humans and animals.

Sequence variation of 16S rRNA gene primer-binding sites.

Fig. 8. Expression of other genomic-clustered Chrn subunits in the mesodiencephalon.(A) Schematic representation illustrating the assembly of the Chrnb4,

Figure 1a. Insertion of sequence into Claudi capsid gene

ITS rRNA gene locus. ITS rRNA gene locus. Schematic of the eukaryotic ribosomal gene cluster. The SILVA database contains sequences of the 18S gene, while.

Spatial cues direct neuronal diversification with respect to OR gene selection. Spatial cues direct neuronal diversification with respect to OR gene selection.

Nucleotide sequences of the IS1016-bexAdeletion region of type b strain Hib and type a strains 1, 2, and 5. Nucleotide sequences of the IS1016-bexAdeletion.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

The truncating mutation c

Intrastrand biases (nucleotide skew) in the T4 genome.

A, Schematic diagram of identified splice variants of PD-L1.

Driver pathways and key genes in OSCC

Fig. 3 Genome editing of the MSTN gene.

Presentation transcript:

22 kDa a-coixin gene cluster Supplemental Fig. S2 – (A) Alignment of sequences amplified from the coix genome using sequence specific and degenerated primers. Only full length α-coixin are represented. The coix genomic sequence containing a cluster of 22 kDa α-coixins from Coix lacryma jobi (by Zhou, L. et al. 2010) were used as template to align the amplified 22 kDa α-coixin. Boxes represent the 22 kDa and 22 kDa-like α-coixin amplified in this work aligned to the previous published genomic sequence. The numbers at the extremities of the box indicate the position of the gene in the genomic region and the numbers above the boxes indicate identical/total nucleotides and the % similarity between our sequences and the published ones. The blue box refers to the 22 kDa -coixin 6 previously annotated as a 22 kDa pseudo α-prolamin because of a premature stop-codon. In our sequence this stop codon is absent and the gene constitute a full length 22 kDa -coixin. Red boxes indicate 22 kDa α-coixins containing 12 -helix domains. (B) New prolamin referred to 22 kDa α-coixin 7 identified in this work. This new 22 kDa α-coixin possess only 79% a similarity at nucleotide level against the genomic region containing the 22 kDa α-coixin cluster and is located in a different genomic region. 22 kDa a-coixin gene cluster 22 kDa α-coixin 7 Located elsewhere in the coix genome 578/733 (79%) 1 283.037 ... 60.000 22 kDa α-coixin 4 22 kDa α-coixin 5 181.176 180.314 α-coixin 2 861/863 (99%) 862/863 (99%) 864/868 (99%) α-coixin 3 857/861 (99%) 249.644 248.778 α-coixin 1 206.233 207.092 857/860 (99%) 22 kDa-like α-coixin 1 85.013 991/944 (99%) 84.070 174.744 173.884 177.100 177.962 22 kDa-like α-coixin 2 997/999 (99%) 61.856 60.858 22 kDa α-coixin 6 253.867 908/910 (99%) 252.937 A B