Quiz#3 LC710 9/29/10 name____________

Slides:

Advertisements

Similar presentations

Eukaryotic Gene Finding

Advertisements

Relationship between Genotype and Phenotype

Transcription and Translation. Central Dogma of Molecular Biology Proposed by Crick DNA  RNA  Protein.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Variant Prioritization in Disease Studies. 1. Remove common SNPs Credit: goldenhelix.com.

Review of Protein Synthesis. Fig TRANSCRIPTION TRANSLATION DNA mRNA Ribosome Polypeptide (a) Bacterial cell Nuclear envelope TRANSCRIPTION RNA PROCESSING.

Eukaryotic Gene Structure. 2 Terminology Genome – entire genetic material of an individual Transcriptome – set of transcribed sequences Proteome – set.

Class summary and homework for February 2 since we missed 2 consecutive classes, this class consisted of a review and going over the 2 pending homework.

Finding genes in the genome

Visualization of genomic data Genome browsers. UCSC browser Ensembl browser Others ? Survey.

COURSE OF BIOINFORMATICS Exam_30/01/2014 A.

TRANSCRIPTION DNA – RNA – Protein. Types of RNA  Messenger RNA (mRNA) - is a copy of a portion of the original DNA strand  carries the RNA copy of the.

Genetic Code and Interrupted Gene Chapter 4. Genetic Code and Interrupted Gene Aala A. Abulfaraj.

Figure S1. Statistics of the distances from IPACs to nearby genes

Bioinformatics for Research

Eukaryotic Gene Structure

Experimental Verification Department of Genetic Medicine

Name:_______________

Quiz #5 (9%) Biol710 11/7/12 name___________

Quiz#3 LC710 10/17/12 name____________ Q1(4%)

Relationship between Genotype and Phenotype

Quiz#6 LC710 10/13/10 name___________

Polymorphisms GWAS traits.

Quiz#7 LC710 10/18/10 name___________

From Gene to Protein.

P. M. Kelley, D. J. Harris, B. C. Comer, J. W. Askew, T. Fowler, S. D

Volume 163, Issue 3, Pages (October 2015)

Mutation of a Nuclear Respiratory Factor 2 Binding Site in the 5′ Untranslated Region of the ADSL Gene in Three Patients with Adenylosuccinate Lyase Deficiency

Quiz#4 LC710 11/14/11 name___________

Section: ___ Time of lab:______8th or 9th floor (circle)

α1-Adrenoceptor Subtype Selectivity and Lower Urinary Tract Symptoms

Polymorphisms GWAS traits.

Volume 84, Issue 3, Pages (February 1996)

Quiz#2 LC710 10/15/12 name____________

Quiz#1 LC710 10/10/12 name____________

Quiz#6 LC710 10/13/10 name___________

A Novel Gene Causing a Mendelian Audiogenic Mouse Epilepsy

Volume 20, Issue 12, Pages (June 2010)

Quiz#4 LC710 10/04/10 name___________

Mutations in a Novel Gene with Transmembrane Domains Underlie Usher Syndrome Type 3 Tarja Joensuu, Riikka Hämäläinen, Bo Yuan, Cheryl Johnson, Saara.

Molecular Characterization of WFS1 in Patients with Wolfram Syndrome

Volume 117, Issue 3, Pages (September 1999)

High Frequency Retrotransposition in Cultured Mammalian Cells

20pts total 5’ 3’ Quiz 3: Biol 302 Spring2011 Name:_______________

Heat Shock Factor Protein Family of Transcription Factors

Quiz#1b LC710 11/05/17 name____________

Quiz#1a LC710 11/05/17 name____________

BLAT Blast Like Alignment Tool

Where would you draw the polyA tail in the gene above?______________

20pts total 5’ 3’ Quiz 3: Biol 302 Spring2011 Name:_______________

A Novel Family of Divergent Seven-Transmembrane Proteins

Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L

Bioinformatics 김유환, 문현구, 정태진, 정승우.

Ataxia with Isolated Vitamin E Deficiency: Heterogeneity of Mutations and Phenotypic Variability in a Large Number of Families Laurent Cavalier, Karim.

Sex-Linked period Genes in the Silkmoth, Antheraea pernyi

Corticotropin Releasing Factor Receptor Type 1: Molecular Cloning and Investigation of Alternative Splicing in the Hamster Skin Alexander Pisarchik,

Schematic drawing of alternatively-spliced GFP reporter gene.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Unit 4 - The Natural Environment and Species Survival

iraL shares sequence identity with iraM from E

Gene Structure.

Mutations in the Gene Encoding Capillary Morphogenesis Protein 2 Cause Juvenile Hyaline Fibromatosis and Infantile Systemic Hyalinosis Sandra Hanks,

(A) yellow cDNA comparison among wild-type and ch mutants

Volume 53, Issue 5, Pages (May 1998)

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

M L L L V L L V V L I L L I V R R Predicted transmembrane domain

Volume 9, Issue 16, Pages S1-868 (August 1999)

Identification of a New Splice Form of the EDA1 Gene Permits Detection of Nearly All X- Linked Hypohidrotic Ectodermal Dysplasia Mutations Alex W. Monreal,

A, Schematic diagram of identified splice variants of PD-L1.

Gene Structure.

Presentation transcript:

Quiz#3 LC710 9/29/10 name____________ Q1(1pt) Given the following protein: Nt- MNTSFSMLAAYMFLLIMLGFAINEAAFLTLYVTVLNYILLNLAVADEFRVFGGFTAT LYTSLGFFATLGGEIEALHWSLDVLAIERYVVVAIMGVAFTWVMALACAAVSLSFV IYMFVVHFIDIALRIVEIFFCYGMVIIMVIADFLICWELPYAGVAFYIFTHAFFAKKR TSAVYNPVIYIMMN-Ct Circle the potential transmembrane domains. There are more than 1. _______________________________________________ Q2(1pt) Given the following Kyte-Doolittle hydropathy plot: Circle on the number line where transmembrane regions reside.

Q3(3pt) Given the following protein: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML * * = STOP You want to PCR up this conserved protein from an unknown species. -Design a fully degenerate oligo to the underlined Nt amino acids and include an extra EcoR1 site (GAATTC) at the 5’ end. This is a top strand oligo. -Design a fully degenerate oligo to the underlined Ct amino acids and include an extra BamHI site (GGATCC) at the 5’ end. This is a bottom strand oligo. Write both oligos 5’ to 3’. Make sure to annotate 5’ and 3’ ends of your two oligos. Genetic Code: (1pt) Oligo 1:_______________________________ Oligo 2:_______________________________ (2pt) _____________________________________________________ Q4(1pt) Given the following Gene below: Using the following list of symbols: ATG, STOP, SD, SA, 5’UTR, 3’UTR Completely label the gene below with these symbols SD: splice donor SA: splice acceptor UTR: untranslated region KEY: 3’ 5’ ____________________________________________________ (1pt) Extra Credit: AATAAA is a polyA recognition site. Using an arrow show approximate position in gene above.