Figure 1. Variable region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline sequence is shown in full, with.

Slides:

Advertisements

Similar presentations

Lecture 2 Antigens, Receptors and Immunoglobulins.

Advertisements

MLRS 242 Immunology Pat Reed Antibodies

Antibody structure & function Lecture 9 13/10/2015.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Figure 1. Mass of rapid insulin secretory bursts and ApEn values in young and old subjects. Increased Disorderliness of Basal Insulin Release, Attenuated.

Figure 2. ROC curves for fasting values (A) and OGTT values (B) for detecting insulin resistance in PCOS women. Sensitivity is plotted against 1 − specificity.

M protein detection and characterization

IMMUNOGLOBULIN STRUCTURE AND GENES THAT CODE FOR THEM

Figure 2. Summary of trial events

(Adapted, with permission, from Fagin JA

Figure 1. Twenty-four-hour plasma ACTH concentrations in insomniacs (▪) and controls (○). The thick black line indicates the sleep recording period. The.

Fig. 1. Schematic representation of ProCT and the other CT precursors (CTpr) derived from this prohormone (i.e. NProCT, CT-CCP-I, and CCP-I). The mean.

Circadian Rhythms of Women with Fibromyalgia1

Figure 1. Schematic representation of TSHR

Fig. 1. Mean BMI and BMI Z-score (se) of the children with AA, TA, and TT genotypes in rs of the FTO gene. The P values are for the additive model.

Fig. 1. Correlation of TSH with TC, LDL-C, HDL-C, and TG.

Fig. 1. Study enrollment and disposition of participants

Nat Clin Pract Endocrinol Metab 3: 279–289 doi: /ncpendmet0447

Nat. Rev. Endocrinol. doi: /nrendo

Figure 1. Circadian pattern of gastric pH in healthy control subjects documented before (P1) Ramadan, on the 10th day (P2) and on the 24th day (P3) of.

Figure 1. Consort flow diagram.

Invest. Ophthalmol. Vis. Sci ;55(3): doi: /iovs Figure Legend:

Fig. 1. BAT activity before and after WL

Quantified net intensity data are in arbitrary units (AU)

Figure 5. Both IDs Are Capable of Functionally Interacting with the TR on Positive TREs CV-1 cells were cotransfected with 1.7 μg of LYS (A) PAL (B), or.

HT (n = 45), healthy control subjects (HC) (n = 22), DTC-I, recurrent or persistent DTC (n = 27), DTC-II, disease free DTC (n = 34). Tg clusters are defined.

Figure 1. Serum B-ALP levels in normal male (•) and female (○) children as a function of age. Serum B-ALP levels were increased during infancy and puberty.

IMMUNOGLOBULIN STRUCTURE AND FUNCTION

Figure 1. Total (A) and free (B) T, estradiol (C), and SHBG (D) levels at baseline and during treatment. From: Testosterone Treatment and Sexual Function.

Fig. 5. Histopathological study of the tumor tissue removed from patient 2. A, Macroscopic view of a tumor slice showing a dense tissue occupying the center.

Figure 1. Analysis of four different hPRLR mRNA isoforms (L, I, S1a, and S1b) in human breast adipose tissue (Breast AT), sc abdominal.

Figure 1. Summary of PTH secretion from human parathyroid cells after caffeine treatment at concentrations of 0, 1, 10, and 50 μm at extracellular calcium.

Predicted values and SEs were based on linear mixed models

Figure 1. Melatonin levels in CSF of control subjects (n = 82) and AD patients (n = 85). *, P< Decreased Melatonin Levels in Postmortem Cerebrospinal.

Figure 1. Serum concentrations of IGF-I (A), IGF-II (B), IGFBP-3 (C), and ALS (D) throughout life in GHD (closed circles) and healthy control (open circles)

From: Is Age a Risk Factor for Hypothyroidism in Pregnancy

Figure 1. Correlations between TNFα and HOMA IR in men (•) and women (○). Circulating Tumor Necrosis Factor-α Concentrations in a Native Canadian Population.

Figure 1. MRI study demonstrating the change in visceral and sc abdominal fat area in a typical pioglitazone-treated patient. Each picture shows a transverse.

Fig. 1. Serum levels of IGF-I vs

Bound antibodies Creative Biolabs provides anti-idiotypic antibody production service detecting FREE antibodies. We have extensive experience in developing.

Analysis of expressed immunoglobulin heavy chain genes in familial B-CLL by Akira Sakai, Gerald E. Marti, Neil Caporaso, Stefania Pittaluga, Jeffrey W.

by David W. Bahler, John A. Miklos, and Steven H. Swerdlow

Determination of allergen specificity by heavy chains in grass pollen allergen–specific IgE antibodies Elisabeth Gadermaier, PhD, Sabine Flicker, PhD,

Mutation Analysis of the Rearranged Immunoglobulin Heavy Chain Genes of Marginal Zone Cell Lymphomas Indicates an Origin From Different Marginal Zone B.

Christoph M. Hammers, Jing Chen, Chenyan Lin, Stephen Kacir, Don L

by Christian H. Ottensmeier, and Freda K. Stevenson

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

Analysis of clonotypic switch junctions reveals multiple myeloma originates from a single class switch event with ongoing mutation in the isotype-switched.

The figure shows representative tissue from multiple gastric biopsies in which the expression of parathyroid hormone related peptide (PTHrP) was investigated.

The future of protein secondary structure prediction accuracy

Efficacy of Serologic Marker Screening in Identifying Hepatitis B Virus Infection in Organ, Tissue, and Cell Donors Dominique Challine, Stéphane Chevaliez,

The Differentiation of Vertebrate Immune Cells

Nat. Rev. Endocrinol. doi: /nrendo

Regions of sequence homology across dominant clones in TLR7tg animals.

Volume 17, Issue 11, Pages (November 2009)

Volume 24, Issue 1, Pages (January 2016)

Characterization of an Autoantigen Associated With Chronic Ulcerative Stomatitis: The CUSP Autoantigen is a Member of the p53 Family1 Lela A. Lee, Patrick.

Characterization of a Novel Isoform of α-Nascent Polypeptide-associated Complex as IgE-defined Autoantigen Roschanak Mossabeb, Susanne Seiberler, Irene.

Volume 6, Issue 4, Pages (April 1996)

Primary Cutaneous Follicle Center Cell Lymphomas and Large B Cell Lymphomas of the Leg Descend from Germinal Center Cells. A Single Cell Polymerase Chain.

Susceptibility to Thyroid Disorders in Hepatitis C

Structure and conformation of κ light chain (LC).

Janet A. Fairley, Chang Ling Fu, George J. Giudice

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Volume 55, Issue 3, Pages (March 1999)

Volume 17, Issue 6, Pages (November 2016)

Antigen Selection of Anti-DSG1 Autoantibodies During and Before the Onset of Endemic Pemphigus Foliaceus Ye Qian, Stephen H. Clarke, Valeria Aoki, Gunter.

Volume 13, Issue 1, Pages (July 2000)

Nat. Rev. Clin. Oncol. doi: /nrclinonc

Bcl-2 Obstructs Negative Selection of Autoreactive, Hypermutated Antibody V Regions during Memory B Cell Development Shailaja Hande, Evangelia Notidis,

Presentation transcript:

Figure 1. Variable region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline sequence is shown in full, with amino acid mismatches of Fab heavy chains indicated. CDR regions are shown in bold type. Alignments are shown for V<sub>H</sub>1 heavy chains (a) and V<sub>H</sub>3 heavy chains (b). Germline V regions are from Ref. 17, except DP-58 (19). The following have identical V region amino acid sequences; 126TO3H (shown), 7H, and 14H; 126BH (shown), IH, 126TO9H, and 126TP7H; 126TP10H (shown) and 15H; and 131TP2H (shown), 6H, 11H, and 15H. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11):3818-3825. doi:10.1210/jcem.82.11.4348 J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

Figure 2. Junction region amino acid sequences of TPO-reactive Fab heavy chains. The putative most homologous germline D and J sequences are shown in full, with amino acid mismatches of TPO-reactive Fab heavy chains indicated. CDR regions are shown in bold type. Alignments are shown for V<sub>H</sub>1 heavy chains (a) and V<sub>H</sub>3 heavy chains (b). Germline D regions are from D21–10 (20), D5/D5a (21), DK1 (22), and D3 and D2 (23). Germline J regions are from Ref. 24. The following have identical D/J region amino acid sequences; 126TO3H (shown), 7H, and 14H; 126TO1H (shown) and 126TP13H; 126AH (shown) and GH; 126BH (shown), IH, and 126TP10H; and 131TP2H (shown), 5H, 6H, 7H, 8H, 11H, and 15H. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11):3818-3825. doi:10.1210/jcem.82.11.4348 J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

Figure 3. Variable region amino acid sequences of TPO-reactive Fab κ-chains. The putative most homologous germline sequence is shown in full, with amino acid mismatches of Fab κ-chains indicated. CDR regions are shown in bold type. Alignments are shown for V<sub>κ</sub>1 κ-chains (a) and V<sub>κ</sub>3 κ-chains. Germline variable regions are from Ref. 18, except K9 (25). The following have identical V region amino acid sequences; 126TP5K (shown), 9K, and 14K; 126TO2K (shown), 3K, 7K, and 14K; 126TO1K (shown), 126TP15K, 131TP2K, and 11K; 131TP5K (shown), 7K, 8K, and 15K; 126CK (shown) and FK; 126AK (shown), BK, IK, JK, and 126TP1K; and 126TP8K (shown) and 10K. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11):3818-3825. doi:10.1210/jcem.82.11.4348 J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

Figure 4. Junction region amino acid sequences of TPO-reactive Fab κ-chains. The putative most homologous germline J sequence is shown in full, with amino acid mismatches of TPO-reactive Fab κ-chains indicated. CDR regions are shown in bold type. Germline J regions are from Ref. 26. The following have identical J region amino acid sequences; 131TP5K (shown), 7K, 8K, and 15K; 131TP2K (shown), 6K, and 11K; 126AK (shown), BK, CK, DK, FK, HK, IK, JK, 126TP1K, 6K, 7K, 8K, 10K, 13K, 15K, and 126TO10K; 126TO2K (shown), 3K, 7K, 14K, 126TP5K, 9K, and 14K; and 126GK (shown) and 126TO8K. Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11):3818-3825. doi:10.1210/jcem.82.11.4348 J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society

Figure 5. Inhibition of TPO Ab binding from the serum of five patients with HT by TPO-reactive Fab. TPO Ab binding was determined in the presence of no Fab, a single Fab, or two Fab. Examples are shown from HT126 serum (Fab1 = 126B, Fab2 = 126TP13), serum 1 (Fab1 = 126TO10, Fab2 = 131TP2), serum 2 (Fab1 = 126TO10, Fab2 = 131TP7), serum 3 (Fab1 = 126B, Fab2 = 131TP2), and serum 4 (Fab1 = 126B, Fab2 = 131TP15). Analysis of Immunoglobulin Gκ Antithyroid Peroxidase Antibodies from Different Tissues in Hashimoto’s Thyroiditis1 J Clin Endocrinol Metab. 1997;82(11):3818-3825. doi:10.1210/jcem.82.11.4348 J Clin Endocrinol Metab | Copyright © 1997 by The Endocrine Society