The Human-Mouse: Disease Connection in MGI (BETA)

Slides:



Advertisements
Similar presentations
Module 2 Navigation.     Homepage Homepage  Navigation pane that holds the Applications and Modules  Click the double down arrow on the right of.
Advertisements

KompoZer. This is what KompoZer will look like with a blank document open. As you can see, there are a lot of icons for beginning users. But don't be.
MouseMine: Mouse Gene Lists (and a whole lot more) Joel Richardson.
The Maize Inflorescence Project Website Tutorial Nov 7, 2014.
Welcome to the Adding/ Editing Historical Immunizations lesson for the North Carolina Immunization Registry. This lesson is intended for all User Roles.
WELCOME TO THE ANALYSIS PLATFORM V4.1. HOME The updated tool has been simplified and developed to be more intuitive and quicker to use: 3 modes for all.
D-1 Management Information Systems for the Information Age Copyright 2004 The McGraw-Hill Companies, Inc. All rights reserved Extended Learning Module.
Mouse Genome Informatics November 2008 Paul Szauter MGI User Support.
PowerPoint: Tables Computer Information Technology Section 5-11 Some text and examples used with permission from: Note: We are.
Click the mouse to continue. Aligning cell contents You align data in a cell in relation to the edges of the cell. Aligned on the right side of the cell.
How to annotate an X-ray in the client file PURPOSE - To mark up x-rays or other images after they are loaded to the client file PREREQUISITES - Basic.
1 Access Lesson 3 Creating Queries Microsoft Office 2010 Introductory Pasewark & Pasewark.
1 Access Lesson 3 Creating Queries Microsoft Office 2010 Introductory.
Working with the Conifer_dbMagic database: A short tutorial on mining conifer assembly data. This tutorial is designed to be used in a “follow along” fashion.
Transferring Course Materials to the Web. Creating a Web Site With a Template To create a Web site with a template 1.Start FrontPage. 2.On the File menu,
July 2015 CSHL Data analysis: GO tools and YeastMine, use-case examples.
PhenCode Linking Human Mutations to Phenotype. PhenCode Brings the deep information on genotypes and phenotypes in locus specific databases (LSDBs) into.
Info copied from Microsoft Help Files Excel: Introduction Microsoft Office 2003.
How to use the internet The internet is a wide ranging network that thousands of people use everyday. It is a useful tool in modern society that once one.
Fission Yeast Computing Workshop -1- Searching, querying, browsing downloading and analysing data using PomBase Basic PomBase Features Gene Page Overview.
GeneWise and Artemis Exercises Spliced Alignment using GeneWise Click on the GeneWise hyperlink on the course links page,
Galaxy for Bioinformatics Analysis An Introduction TCD Bioinformatics Support Team Fiona Roche, PhD Date: 31/08/15.
UCSC Genome Browser 1. The Progress 2 Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools.
D-1 Extended Learning Module D Decision Analysis With Spreadsheet Software.
RGD’s Genome Viewer: Definition and Basic Features.
How to Start Using MyData. So you’re new to MyData… 1.The shortcut to the MyData website is 2.This will.
I NTRODUCTION TO DATABASES - P RACTICAL. Q UERY S EQUENCE >my weird new protein MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT.
An Inspiration Software Tutorial INDEX Changing a Symbol in Inspiration Adding a Symbol in Inspiration Moving a Symbol in inspiration Adding text under.
Copyright OpenHelix. No use or reproduction without express written consent1.
Copyright OpenHelix. No use or reproduction without express written consent1.
Updated on: September 4, 2010 CIS67 Foundations for Creating Web Pages Professor Al Fichera.
1 Excel Lesson 1 Microsoft Excel Basics Microsoft Office 2010 Pasewark & Pasewark.
December 2011 n 4ce Quick Start Guide Sections Profiles are generated in n 4ce as either Long or Cross Sections. Sections can be positioned in plan using.
Copyright OpenHelix. No use or reproduction without express written consent1.
This tutorial will describe how to navigate the section of Gramene that allows you to view various types of maps (e.g., genetic, physical, or sequence-based)
Creating a multi-page form using Tab Controls. In today’s class, we will be using the Tab Control method to create the Form / SubForm combination.
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
Introduction to Exome Analysis in Galaxy Carol Bult, Ph.D. Professor Deputy Director, JAX Cancer Center Short Course Bioinformatics Workshops 2014 Disclaimer…I.
Chapter 8 Using Document Collaboration, Integration, and Charting Tools Microsoft Word 2013.
PowerTeacher Gradebook PTG and PowerTeacher Pro PT Pro A Comparison The following slides will give you an overview of the changes that will occur moving.
AdisInsight User Guide July 2015
T3/Tutorials: Data Submission
Going Green By Ima Librarian
SAGExplore web server tutorial for Module III:
Decision Analysis With Spreadsheet Software
Microsoft Excel Basics
PowerPoint: Tables and Charts
Excel 2010 Screen Symbols.
Word 2002 Chapter 7 MANIPULATING TABS.
Project Management Skills.
Boeing Supply Chain Platform (BSCP) Detailed Training
Lippincott Procedures Training Tour for HealthStream Users
Genetics Using Punnett Squares
MODULE 7 Microsoft Access 2010
Project Management Skills
This tutorial is designed to be used in a “follow along” fashion
Deep Phenotyping for Deep Learning (DPDL): Progress Report
Fusion 360 Pac Man Tutorial
Training Presentation for Supply Chain Platform: BAE Systems
BIOL 3020 GENOMIC BIOLOGY LABORATORY 05A
Welcome to the Quantitative Trait Loci (QTL) Tutorial
Gramene’s Ontologies Tutorial
Enter your gene of interest here
Lippincott’s Nursing Procedures and Skills
More Genetics Bio 12.
Test Administrator training — Part A
MECH 3550 : Simulation & Visualization
Genetics Using Punnett Squares
Lesson 13 Working with Tables
Presentation transcript:

The Human-Mouse: Disease Connection in MGI (BETA) Short Course Bioinformatics Workshops July 2014

Connecting Mouse Models to Human Disease The Human Mouse Disease Connection, or HMDC, is a clinical genetic research and translational tool allowing a rapid, visual association between genes and their phenotypes. You can begin with a gene list such as one derived from an exome sequencing result in a specific mouse or human patient, a genomic region defined by a GWAS or QTL association study, a disease, or an observed phenotype.

HMDC in a Nutshell Search for mouse models by gene symbol (mouse or human) exome results (VCF file) genome locations key words Quick access to phenotype and disease annotations, references, mouse model availability

Mouse Genome Informatics http://www.informatics.jax.org

To access the HMDC, simply click on the button from the Mouse Genome Informatics homepage. On the Human-Mouse Disease connection homepage, three boxes appear allowing you to begin your search by gene, genome location or disease terms. You additionally have the option to upload a VCF file or a text file with gene symbols. Below the search boxes on the left, you can see a page tour, a quick introduction to mouse genetics and a glossary; and on the right, a spotlight section which compares a specific human disease to it’s mouse model.

Search by Gene Symbol Gja8 Mapk10 Rsph9 Il20ra Jak3 Frg1 Please notice as well that entry of both human and mouse gene symbols, locations and annotations are supported. In this example, we’ll run a simple “genes” search with the following 6 genes, simply by pasting them into the first window on the left.

View associated gene, phenotype and disease results Mammalian (mouse) Phenotypes Human disease (OMIM) This reveals a visual grid of associated phenotype and disease results. Each row corresponds to a gene, and then each column represents a phenotype or disease association. Coloured boxes at the intersection indicate that a particular gene has an annotation within that system. <click> On the left of the grid, in blue, you see mammalian phenotype systems which comes from mouse data and annotations. On the right, you see human diseases, where orange indicates that the gene has been associated from studies in human patients and loaded from OMIM, and blue indicates that a mutant mouse has been described as a model of the human disease. Bi-coloured boxes with both blue and orange indicate that mutations in this gene have been disease-associated in both species. I’ll also draw your attention to the additional “Genes” and “Diseases” tabs in behind, which we’ll look into later

Click to view MP terms and genotypes A very light coloured box, such as here at the intersection of Interleukin 20 and “cellular phenotype” may bring up a single annotation, where you can see the precise allele in which a cellular phenotype was reported, along with the more specific term of “osteoclast differentiation” Clicking on a dark coloured box, as seen at the intersection of Jak3 and “immune system”, reveals multiple Jak3 alleles and many more precise terms under the umbrella of immune system.

Disease associations Similarly, on the right side of the grid, clicking the cells with data will reveal the details of gene-disease associations. Gap junction 9 is an example of a gene which has been associated to cataracts in both humans and mouse, and you can see that four different alleles in the mouse have all been used as cataract disease models.

Filter grid by phenotype and gene (select what you want to keep) Along with exploring and drilling down into the data, it is possible to apply filters for both columns and rows which will hide any systems or genes that have no data in the selections. This will filter all tabs.

Tabs for Genes & Diseases information Along with the grid, I’ll remind you that there is also a Genes and Diseases tab.

Genes tab: References and mouse models

IMSR = International Mouse Strain Resource www.findmice.org

Diseases tab: Disease and mouse model details

In this case both the mouse gene and human ortholog are associated with the Cataract 1 disease.

In this case different mouse and human genes are associated with the disease.

Search by genes in VCF files An example vcf file is available on the Dropbox site

Search terms can be combined . Chr1:150000000-250000000 type “cleft palate” (matches whole) or type cleft palate (matches as two terms) or select cleft palate Mammalian phenotype Cleft Palate; CP [Cleft palate isolated, CPI] OMIM

Results for a search by both genome region and key word at least one mouse homolog genotype contains “cleft palate” (or child term) as an MP annotation same MP genotype is a disease model, or human disease name/synonym contains “cleft palate”

Summary The Human-Mouse: Disease Connection supports rapid access to disease and phenotype associations The HMDC is in Beta release contact mgi-help@jax.org with questions and suggestions

Your Turn ! Use the HMDC for a disease, gene, or phenotype you are interested in or have heard about at the Short Course Try the human.vcf file on the DropBox site https://www.dropbox.com/sh/seqishl631f363x/AADoBskzYjPt_iJI21dxJqV8a