[Rz/Rz1, LysB/LysC, gp u/v] proteins of Lytic Cassette

Slides:

Advertisements

Similar presentations

Phage BruceB, cluster G Et2Brutus, cluster A2.

Advertisements

Annotation standards in ORegAnno (Draft) Obi Griffith The RegCreative Jamboree Nov 29, 2006 Ghent, Belgium.

Analysis of lytic proteins pinholin and Rz/Rz1 Sue Parks and Lawangin Khan.

Genome databases and webtools for genome analysis Become familiar with microbial genome databases Use some of the tools useful for analyzing genome Visit.

The design, construction and use of software tools to generate, store, annotate, access and analyse data and information relating to Molecular Biology.

BIOINFORMATICS Ency Lee.

Psi-BLAST, Prosite, UCSC Genome Browser Lecture 3.

Biological Databases Notes adapted from lecture notes of Dr. Larry Hunter at the University of Colorado.

Sequence/Structure Alignment Resources from NCBI Steve Bryant Protein Data Bank Rutgers University November 19, 2005.

PREDICTION OF PROTEIN FEATURES Beyond protein structure (TM, signal/target peptides, coiled coils, conservation…)

Protein and Function Databases

Bacteriophage Gene Functions Welkin Pope SEA-PHAGES In Silico Workshop, 2014.

Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.

Making Sense of DNA and protein sequence analysis tools (course #2) Dave Baumler Genome Center of Wisconsin,

Automatic methods for functional annotation of sequences Petri Törönen.

Wellcome Trust Workshop Working with Pathogen Genomes Module 3 Sequence and Protein Analysis (Using web-based tools)

Bikash Shakya Emma Lang Jorge Diaz.  BLASTx entire sequence against 9 plant genomes. RepeatMasker  55.47% repetitive sequences  82.5% retroelements.

What is comparative genomics? Analyzing & comparing genetic material from different species to study evolution, gene function, and inherited disease Understand.

발표자 석사 2 년 김태형 Vol. 11, Issue 3, , March 2001 Comparative DNA Sequence Analysis of Mouse and Human Protocadherin Gene Clusters 인간과 마우스의 PCDH 유전자.

Module 3 Sequence and Protein Analysis (Using web-based tools) Working with Pathogen Genomes - Uruguay 2008.

Genome databases and webtools for genome analysis Become familiar with microbial genome databases Use some of the tools useful for analyzing genome Visit.

Functional Annotation of Proteins via the CAFA Challenge Lee Tien Duncan Renfrow-Symon Shilpa Nadimpalli Mengfei Cao COMP150PBT | Fall 2010.

BLAST Basic Local Alignment Search Tool (Altschul et al. 1990)

Biological Databases Biology outside the lab. Why do we need Bioinfomatics? Over the past few decades, major advances in the field of molecular biology,

Computational Genomics and Proteomics Lecture 8 Motif Discovery C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E.

A Tutorial of Sequence Matching in Oracle Haifeng Ji* and Gang Qian** * Oklahoma City Community College ** University of Central Oklahoma.

Biological databases Exercises. Discovery of distinct sequence databases using ensembl.

Mysterious Sequence Repeats in Phage Genomes AKHIL GARG BNFO 301 APRIL 30, 2015.

NCBI Genome Workbench Chuong Huynh NIH/NLM/NCBI Sao Paulo, Brasil July 15, 2004 Slides from Michael Dicuccio’s Genome Workbench.

Genome annotation and search for homologs. Genome of the week Discuss the diversity and features of selected microbial genomes. Link to the paper describing.

Bioinformatics Lecture to accompany BLAST/ORF finder activity

Annotation of Drosophila virilis Chris Shaffer GEP workshop, 2006.

Bacteriophage Gene Functions Welkin Pope SEA-PHAGES Bioinformatics Workshop, 2015.

Large-scale Prediction of Yeast Gene Function Introduction to Bio-Informatics Winter Roi Adadi Naama Kraus

Tweaking BLAST Although you normally see BLAST as a web page with boxes to place data in and tick boxes, etc., it is actually a command line program that.

Doug Raiford Phage class: introduction to sequence databases.

Genome Revolution: COMPSCI 004G 8.1 BLAST l What is BLAST? What is it good for?  Basic.

BLAST: Basic Local Alignment Search Tool Robert (R.J.) Sperazza BLAST is a software used to analyze genetic information It can identify existing genes.

Bacteriophage Gene Functions

Protein families, domains and motifs in functional prediction

Prediction of protein features. Beyond protein structure

22 kDa a-coixin gene cluster

Protein Families, Motifs & Domains.

Functional manual annotation including GO

EGASP 2005 Evaluation Protocol

Sequence based searches:

Functional Annotation Final Results

GEP Annotation Workflow

Genome Center of Wisconsin, UW-Madison

Bioinformatics and BLAST

Introduction to Bioinformatics Thursday, 24 January

Gene Annotation with DNA Subway

Ensembl Genome Repository.

Identify D. melanogaster ortholog

Meatgenome Analysis Project Bioinformatics 301

Protein information in the Human Protein Atlas.

Schematic representation of proteogenomic annotation strategy.

Genomic landscapes of the two typical NEs found in this study.

Putative processing of the astrovirus nonstructural proteins expressed from ORF1a and ORF1b. Putative processing of the astrovirus nonstructural proteins.

Problems from last section

iraL shares sequence identity with iraM from E

Alignment of N-terminal sequences of type IV pilin proteins.

GOMASHI ANNOTATION GENES 1-13

TF candidate selection pipeline.

Sequence variation of 16S rRNA gene primer-binding sites.

Figure 1a. Insertion of sequence into Claudi capsid gene

Welkin Pope SEA-PHAGES Bioinformatics Workshop, 2017

Genome organization and polyprotein products of human astrovirus.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

Fig. 3 Genome editing of the MSTN gene.

Presentation transcript:

[Rz/Rz1, LysB/LysC, gp u/v] proteins of Lytic Cassette Lawangin Khan

What are [Rz/Rz1, LysB/LysC, gp u/v] proteins and their purpose? Outer Membrane bound protein, which helps disintegrate the membrane Proteins involved in the last stages of lytic cycle Cleaves the links between the murein and outer membrane (Young et al)

Question What is the purpose of the protein sequence gp u/v and how are they similar to other gp u/v like proteins in other phages?

Sequence of protein v (Rz1, LysC) Krupovic’s experiment, PSI-BLAST (Krupovic et al) MKLNKFLIVLCLPMFAACSTTAPKIETVYLVPPSSLLTECAAPVYPFITWRDLVEAYAKEKAARESCGLQIQEIKNWFKETVPSESRKFQ

Gp v in BioBIKE Tried to find gp u and gp v using Matches of pattern, Matches of item, sequence similar to in the translation of genome, translating some of annotated genes, but could not find sequence in PRD1 through BioBIKE protein blast, NCBI website on the sequence of protein v obtained from Krupovic

Blast results Deteremined sequence of gene v using Gene ID: 5729505

Gp v in PRD1 Searched for sequence in biobike sequence of PRD1 which was located upstream and a few beginning nucleotides of gene PRD1.PRD1_21 13614 -> 13886

Gp u (Rz/LysB) The Gene ID from NCBI also helped me determine location of gp u Repeated same steps to locate gene u on biobike, 13329 -> 13687

Genes similar to gp v

Similar Proteins Most are similar protein which makes sense they are similar to PRD1

Similar proteins analysis In the alignment sequence I noticed beginning of the sequence mainly similar Domain of function predicted it to be transmembrane domain

Analysis Continued

Analysis Continued Krupovic’s experiment: Transmembrane domain was determined by TMHMM (Krupovic et al) (http://www.cbs.dtu.dk/services/TMHMM-2.0/) Single transmembrane domain predicted at beginning of the sequence of gene u. Gene v did not have a transmembrane domain

Peptidase II cleavage site Peptidase II cleavage site was determined by LipoP (Krupovic et al) (www.cbs.dtu.dk/services/LipoP/). The consensus peptidase II cleavage site predicted by Kropuvic is L(A/S)(G/A)C Graph indicats high probability of a cleavage II site for gp v. Gp u did not have a cleavage II site.

Final thoughts Similar domains (transmembrane domain, coiling coil) between similar gp u/v proteins Location of genes in genome Predicted sequence function Transmembrane region Cleavage site Coiling coil Do same study on VCU phage Maverick or Cluster A phages depending on difficulty