Candidate phosphopeptides Verified by mutagenesis Table 1. Identification of novel ERα phosphorylation sites. The combined data for each phosphopeptide were sufficient to identify the phosphorylation site. Verification of sites was performed by mutagenesis and/or validated phosphoantibodies. Phospho-peptide Phospho- amino acid MED release Candidate phosphopeptides Identity Verified by mutagenesis Phospho-antibody A Serine 5 278-GEVG (S) AGDMR-287 Serine 282 + B 4 556-GGA (S) VEETDQSHLATAGSTSSHSLQK-581 Serine 559 C 7 172-GSMAME (S) AK-180 288-AANLWP (S) PLMIK-299 450-SIILLN(S)GVYTFLSSTLK-467 521-GMEHLY(S)MK-529 Serine 294 D 10 38-PLGEVYLDS (S) KPAVYNYPEGAAYEFNAAAAANA QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSV(S)P(S)P LMLLHPPPQL (S) PFLQPHGQQVPYYLENEPSGYTVR-142 184-YCAVCNDY (S) GYHYGVWSCEGCK-206 Serine 47 -