Candidate phosphopeptides Verified by mutagenesis

Slides:

Advertisements

Similar presentations

Tandem MS (MS/MS) on the Q-ToF2

Advertisements

From Genome to Proteome Juang RH (2004) BCbasics Systems Biology, Integrated Biology.

S 3.1 Positive ionization low energy CID fragmentation spectrum of the singly phosphorylated peptide pSLKPDTENQESSVK of Rec 10 MS 3 spectrum of the doubly.

2 Nucleic Acids Convey Genetic Information Box 2-2Table Chapter 2-5.

Chymotrypsin Chymotrypsin is one of the serine proteases.

1 times table 2 times table 3 times table 4 times table 5 times table

Yin-Yang Column for Global Protein Identification Column Technology Inc.

So You Found a Gene ? NOW WHAT ??. How do we determine a genes function? We can infer certain roles based on sequence comparisons (Couple Weeks Ago) These.

Caption N-terminal domain A/B domain: ligand-independent domain AF1: Activation Function 1 DBD: DNA Binding Domain LBD: Ligand Binding Domain: ligand-dependent.

Video Questions What do the following prefixes mean? Mono, Poly, Exo, and End What do you need to have “LIFE”? Draw a picture of an atom. Why do atoms.

Phosphopeptides identification Column technology Inc.,

$100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300 $400 $500 $100 $200 $300.

Tables Learning Support

Question #1 DNA and RNA nucleotides differ in their ___. Write in ALL that apply. a) Phosphate groups b) Nitrogenous bases c) Sugars d) Functions.

Proteomics: Technology and Cell Signaling Presenter: Ido Tal Advisor: Prof. Michal Linial י " ג סיון תשע " ה.

Gene Expression II. Translation Overview Conversion of triplet code into polypeptide Takes place at ribosome in cytoplasm Involves all 3 types of RNA.

Peptide de novo sequencing Peptide de novo sequencing is the analytical process that derives a peptide’s amino acid sequence from its tandem mass spectrum.

Higher Affinity Heptapeptides Against Influenza Hemagglutinin-Sialic Acid Identification for Treating Flu Virus Disease Ahmed ”e” Al Qaffas.

21.6 The Genetic Code and Protein Synthesis

Proteins & Enzymes.

B. Neutral loss triggered MS3 scan of 983.1, 2+

Verifying Trigonometric Identities

TRANSLATION NOTES.

PKA phosphorylates catalytic α‐ and regulatory β‐subunits of AMPK at multiple sites. PKA phosphorylates catalytic α‐ and regulatory β‐subunits of AMPK.

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Transcription & Translation.

Phosphopeptide sequencing by MALDI-TOF/TOF of the C-terminal tail of AtPIP2;1.A, MS/MS spectrum of singly phosphorylated 277SLGSFRSAANV287 (m/z ).

Distribution of phosphorylation sites identified in the cytosolic phosphoproteome.A, numbers of approved phosphopeptides, previously phosphorylated peptides,

PGAM5 is a protein Ser/Thr phosphatase that activates ASK1.

Phosphopeptide sequencing by MALDI-TOF/TOF of the C-terminal tail of AtPIP2;7.A, MS/MS spectrum of singly phosphorylated 270ALGSFRSNATN280 (m/z ).

TRANSLATION NOTES.

FOXO3 is phosphorylated by cyclin D3/CDK6 complex on S325

Volume 31, Issue 3, Pages (August 2008)

S-Phase entry upon ectopic expression of G1 cyclin-dependent kinases in the absence of retinoblastoma protein phosphorylation Xiaohong Leng, Lisa Connell-Crowley,

Volume 19, Issue 5, Pages (May 2012)

LO: I understand how and why proteins are digested.

Phosphopeptides identified harboring minimal binding motifs

Volume 16, Issue 6, Pages (June 1996)

Proteomics Informatics –

Amino Acids An amino acid is any compound that contains an amino group (—NH2) and a carboxyl group (—COOH) in the same molecule.

A A B C D Fraction number b MCF7 lysate fraction A B C D A B C D GST-p851 GST Kinase assay GST-p851.

Novel phosphorylation sites on H+-ATPase proteins

Table 1. Occurrence of N-X-S/T motives in tryptic peptides1

MCF7z.p85WT MCF7z.p85S83μ MCF7z.p85S83A MCF7.vec MCF7z P-Akt T-Akt

A Novel MAP Kinase Regulates Flagellar Length in Chlamydomonas

Volume 8, Issue 5, Pages (November 2001)

Dynamic changes of protein phosphorylation identify ERK1/2 substrates from cytosolic and nuclear compartments. Dynamic changes of protein phosphorylation.

Time course of phosphorylation changes at Ser-293, Ser-300, and Ser-232 in PDHE1α following kinase inhibition with DCA. A, relative quantitation over three.

Volume 127, Issue 3, Pages (November 2006)

Volume 34, Issue 4, Pages (May 2009)

Cell cycle-dependent phosphorylation of the translational repressor eIF-4E binding protein-1 (4E-BP1) Kate J. Heesom, Alexandra Gampel, Harry Mellor,

Tauomics and Kinetics in Human Neurons and Biological Fluids

A quantitative phosphoproteomic approach for the identification of cellular CDKL5 targets A quantitative phosphoproteomic approach for the identification.

WES identification of heterozygous compound mutations in ALPI

Translation- Making the Protein

3 times tables.

6 times tables.

WES identification of heterozygous compound mutations in ALPI

Volume 38, Issue 3, Pages (May 2003)

Fig. 2. Histone H3 phosphorylation appears at prometaphase upon C4 treatment.(A) Western blots were realized on cells synchronized at mitotic entry in.

Volume 43, Issue 3, Pages (August 2011)

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Phosphopeptides identified harboring minimal binding motifs

MS3 for peptide identification and mapping phosphorylation sites

Fig. 5. Skin changes after cosmetic facial filler injections on the glabella and/or nasal dorsum. (A-C) Hyaluronic acid-injected patients have skin necrosis.

Mass spectrometry identification of biomarker candidates in the prediagnostic plasmas in the Women's Health Initiative cohort. Mass spectrometry identification.

Volume 127, Issue 3, Pages (November 2006)

Presentation transcript:

Candidate phosphopeptides Verified by mutagenesis Table 1. Identification of novel ERα phosphorylation sites. The combined data for each phosphopeptide were sufficient to identify the phosphorylation site. Verification of sites was performed by mutagenesis and/or validated phosphoantibodies. Phospho-peptide Phospho- amino acid MED release Candidate phosphopeptides Identity Verified by mutagenesis Phospho-antibody A Serine 5 278-GEVG (S) AGDMR-287 Serine 282 + B 4 556-GGA (S) VEETDQSHLATAGSTSSHSLQK-581 Serine 559 C 7 172-GSMAME (S) AK-180 288-AANLWP (S) PLMIK-299 450-SIILLN(S)GVYTFLSSTLK-467 521-GMEHLY(S)MK-529 Serine 294 D 10 38-PLGEVYLDS (S) KPAVYNYPEGAAYEFNAAAAANA QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSV(S)P(S)P LMLLHPPPQL (S) PFLQPHGQQVPYYLENEPSGYTVR-142 184-YCAVCNDY (S) GYHYGVWSCEGCK-206 Serine 47 -