Thyrotropin Alfa Drugbank ID : DB00024

Slides:



Advertisements
Similar presentations
Endocrine function tests
Advertisements

The hypothalamo- pituitary-thyroid axis. Thyrotropin releasing hormone (TRH):- TRH is manufactured in the hypothalamus and transported via the portal.
(Approved investigational)
Denileukin diftitox Drugbank ID : DB00004 Chemical formula :
Adalimumab Drugbank ID : DB00051
Follitropin beta (DB00066) Approved Drug
Omalizumab Drugbank ID : DB00043
Menotropins Drugbank ID : DB00032
Antihemophilic Factor
Aldesleukin Drugbank ID: DB00041
Darbepoetin alfa Drugbank ID : DB
Oprelvekin Drugbank ID : DB00038
Peginterferon alfa-2a Drugbank ID : DB00008
Interferon alfa-n1 Drugbank ID : DB00011
Reteplase Drugbank ID : DB00015
Anti-thymocyte Globulin (Rabbit)
Dulaglutide Drugbank ID : DB09045.
Somatropin recombinant Chemical formula: C990H1532N262O300S7
Alteplase Drugbank ID : DB00009 Protein chemical formula :
Gramicidin D Drugbank ID : DB00027
Epoetin alfa Drugbank ID : DB00016
Elotuzumab Drugbank ID : DB06317.
Thyroglobulin Drugbank ID :DB01584 Molecular Weight (Daltons) :660
TALIGLUCERASE ALFA DB08876 C2580H3918N680O727S g/mol
Rasburicase Drugbank ID: DB00049
Anistreplase Drugbank ID : DB00029
Palifermin Drugbank ID : DB00039
Pegloticase Protein chemical formula : C1549H2430N408O448S8
Albiglutide Drugbank ID : DB09043.
Pegvisomant(DB00082) Approved Drug
Metreleptin Drugbank ID :DB09046
Peginterferon beta-1a Drugbank ID :DB00060
Asfotase Alfa Drugbank ID : DB09105.
Dornase alfa Drugbank ID : DB00003
Insulin Degludec Drugbank ID :DB09564
Salmon Calcitonin Drugbank ID : DB00017
Nivolumab Drugbank ID : DB09035 Molecular Weight (Daltons) :
Serum Albumin Iodinated(DB00064) Approved Drug
Peginterferon alfa-2b Drugbank ID : DB00022
Sargramostim Drugbank ID : DB00020
Pembrolizumab Drugbank ID :DB09037 Half life : 28 days.
Streptokinase (DB00086) Approved Drug
Choriogonadotropin alfa OVIDREL (by EMD Serono)
Natalizumab (Approved, Investigational)
Cetuximab Drugbank ID : DB00002
Daratumumab Drugbank ID : DB09043.
Vedolizumab Protein chemical formula : C6528H10072N1732O2042S42
Insulin Regular Drugbank ID : DB00030
Secretin Drugbank ID : DB00021
Pegfilgrastim Drugbank ID : DB00019
Imiglucerase Protein chemical formula : C2532H3854N672O711S16
Galsulfase (Approved investigational) DB01279
Asparaginase Drugbank ID : DB00023
Idarucizumab Molecular Weight (Daltons) : 47766
Antithrombin Alfa Drugbank ID : DB11166.
Ibritumomab(DB00078) Approved Drug
Sebelipase alfa Protein chemical formula : C1968H2945N507O551S15
Chorionic Gonadotropin (Recombinant)
Human Chorionic Gonadotropin: Description and Mechanisms of Action.
Coagulation Factor XIII A-Subunit (Recombinant)
Pegademase bovine Drugbank ID : DB00061
Ixekizumab Drugbank ID : DB11569 Molecular Weight (Daltons) :146,158
Tositumomab (DB00081) Approved Drug
DB00103 Category : Enzyme Replacement Agents
Methoxy polyethylene glycol-epoetin beta
Chorionic Gonadotropin (Human)
ID DB06720 VELAGLUCERASE ALFA CATEGORY Enzymes.
DB00090  Laronidase C3160H4848N898O881S kDa IV infusion.
TSH Thyroid Stimulating Hormone (Thyrotropin)
The Endocrine System General Function and Organization.
Presentation transcript:

Thyrotropin Alfa Drugbank ID : DB00024 Protein chemical formula : C975H1513N267O304S26 Protein average weight : 22672.9000 Half life : 5 +/- 10 hrs

Description : Indication : Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid cancer. It is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 112 residues containing one N-linked glycosylation site. The alpha subunit is nearly identical to that of human chorionic gonadotropin (hCG), luteinizing hormone (LH), and follicle-stimulating hormone (FSH). The alpha subunit is thought to be the effector region responsible for stimulation of adenylate cyclase (involved the generation of cAMP). The beta subunit (TSHB) is unique to TSH, and therefore determines its receptor specificity. The amino acid sequence of thyrotropin alfa is identical to that of human pituitary thyroid stimulating hormone. Indication : For detection of residueal or recurrent thyroid cancer

Pharmacodynamics : Mechanism of action : Route of elimination : Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.. Mechanism of action : Thyrotropin Alfa binds to the thyrotropin receptors found on any residual thyroid cells or tissues. This stimulates radioactive iodine uptake for better radiodiagnostic imaging. Route of elimination : kidney and liver

Targets : Affected organisms : Thyrotropin receptor Humans and other mammals .

Categories : Patents : Sequence : Diagnostic Agents Country Patent Number Approved Expires United States 5840566 1995-11-24 2015-11-24 Sequence : Alpha chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Beta chain FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY

Brands : Thyrogen Company : Genzyme Inc Description : THYROGEN (thyrotropin alfa for injection) contains recombinant human thyroid stimulating hormone (TSH). Thyrotropin alfa is synthesized in a genetically modified Chinese hamster ovary cell line. Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 118 residues containing one N-linked glycosylation site. The amino acid sequence of thyrotropin alfa is identical to that of human pituitary TSH. Both thyrotropin alfa and naturally occurring human pituitary TSH are synthesized as a mixture of glycosylation variants. Unlike pituitary TSH, which is secreted as a mixture of sialylated and sulfated forms, thyrotropin alfa is sialylated but not sulfated. The biological activity of thyrotropin alfa is determined by a cell-based bioassay. In this assay, cells expressing a functional TSH receptor and a cAMP-responsive element coupled to a heterologous reporter gene, luciferase, enable the measurement of thyrotropin alfa activity by measuring the luciferase response. Used for/Prescribed for : it is used for Performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid cancer. Formulation : Each vial of THYROGEN contains 1.1 mg thyrotropin alfa, 36 mg Mannitol, 5.1 mg Sodium Phosphate, and 2.4 mg Sodium Chloride. Form : lyophilized powder Route of administration : intramuscular preferably the buttocks

Dosage : THYROGEN is indicated as a two-injection regimen Dosage : THYROGEN is indicated as a two-injection regimen. The recommended dosage of THYROGEN is a 0.9 mg intramuscular injection to the buttock followed by a second 0.9 mg intramuscular injection to the buttock 24 hours later. Contraindication : allergic Side effects : Severe allergic reactions (rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); confusion; one-sided weakness; severe or persistent dizziness or headache; shortness of breath or other breathing problems; slurred speech; vision problems. Drug interaction : A total of 57 drugs (176 brand and generic names) are known to interact moderately with Thyrogen (thyrotropin alpha).

References : http://www. rxlist. com/thyrogen-drug. htm http://www