0.005 E. billingiae Eb661 E. amylovora ACW5400

Slides:

Advertisements

Similar presentations

Hw1 Shown below is a matrix of log odds column scores made from an alignment of a set of sequences. (A) Calculate the alignment score for each of the four.

Advertisements

Pollen transcript unigene identifier log 2 -fold change Annotation (BLAST) Unigene L. longiflorum chloroplast, complete genome Unigene

Dichotomy of major bacterial phyla inferred from gene arrangement comparisons Takashi Kunisawa Science University of Tokyo Noda , Japan CODATA06.

Eidhammer et al. Protein Bioinformatics Chapter 4 1 Multiple Global Sequence Alignment and Phylogenetic trees Inge Jonassen and Ingvar Eidhammer.

Construction of Substitution Matrices

Chromosomal Landscapes Refer to Figure 1-7 from Introduction to Genetic Analysis, Griffiths et al., 2012.

Figure S1 Evolutionary relationships of RBG subclasses in Arabidopsis (a) and B. rapa (b). Optimal neighbor-joining trees with sum of branch lengths =

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Rust et al., Figure S1 A B Amino acid sequence comparison and alignment of various bacterial FlgM proteins color- coded according to different physico-chemical.

Molecular Evolution. Study of how genes and proteins evolve and how are organisms related based on their DNA sequence Molecular evolution therefore is.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

WRKY transcription factors in potato genome factors in potato genome

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Supplementary file 1. Construct design of tagged Wnt proteins.

Reads aligned into contigs

Carlos Chuquillanqui1 • Ian Barker1

AtIAA18 AtIAA6 AtIAA19 VvIAA19 AtIAA10 AtIAA20 AtIAA7 AtIAA30 AtIAA11

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Carlos Chuquillanqui1 • Ian Barker1

Molecular Evolution.

Sequence and comparison of the SDS protein.

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

WRKY transcription factors in potato genome factors in potato genome

Bootstrapping in MEGA:

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.

Nic’s genome contains 16,124 variants,

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Phylogenetic trees of RhlA and RhlB homologs.

Next-generation sequencing technology in clinical virology

AtG3BP1 is a homolog of the human HsG3BP1.

Volume 9, Issue 9, Pages (September 2016)

Phylogenetic analysis of replication proteins expressed by bifidobacterial plasmids. Phylogenetic analysis of replication proteins expressed by bifidobacterial.

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

(A) Tiled view of an ESOM map constructed using all 51 metagenome bins assembled from the samples collected in this study, with the white square encompassing.

Phylogenetic tree based on 16S rRNA gene sequence comparisons over 1,260 aligned bases showing the relationship between species of the genus Actinomyces.

Genomic Sequence Analysis of the Mouse Desmoglein Cluster Reveals Evidence for Six Distinct Genes: Characterization of Mouse DSG4, DSG5, and DSG6 Neil.

Species diversity within the P. fluorescens species complex.

Julián Mateus1 • Stef de Haan2 Carlos Chuquillanqui2

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

Molecular Genetics of the Caveolin Gene Family: Implications for Human Cancers, Diabetes, Alzheimer Disease, and Muscular Dystrophy Jeffrey A. Engelman,

Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.

Core genome phylogeny of V. anguillarum strains.

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

A highly conserved six-amino-acid region in the C-terminal CT domain of MARCH8 is responsible for its ability to downregulate TfR. A highly conserved six-amino-acid.

Sequences of two isoforms of Arhgap39/Porf-2 protein in mouse.

Phylogenetic tree of 38 Pseudomonas type strains, based on a concatenated nine-gene MLST analysis. Phylogenetic tree of 38 Pseudomonas type strains, based.

(A) yellow cDNA comparison among wild-type and ch mutants

Alignment of the fast/developmental and IIM MYH genes.

The alignment of P-type ATPase-like domains of TgATPaseP-GC, PfGCα, and PfGCβ with the members of human P4-ATPases. The alignment of P-type ATPase-like.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Assessment of plasmid lateral transfer between representative B

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Phylogenetic network with concatenated 16S rRNA, 23S rRNA, groEL, rpoB, and dnaK sequences (3,009 unambiguously aligned base pairs), including 71 Coxiella-like.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Neonatal HSV-2 genomes are genetically distinct from one another and encompass a broad range of known HSV-2 genetic diversity. Neonatal HSV-2 genomes are.

KIT mutations in GISTs. A, amino acid sequence of KIT exon 11 mutations in clinical GIST biopsies. –, amino acids that are deleted; italicized amino acids,

Phylogenetic tree analysis of the Xenopus type III IFNs (A) with other known IFNs and the putative receptors (B) with relevant receptor families. Phylogenetic.

Relationship of partial rpoB gene sequences inferred by the neighbor-joining method for Canadian study strains of C. pyruviciproducens. Relationship of.

John Gray, Pam S Close, Steven P Briggs, Gurmukh S Johal Cell

Sequence alignment of colicin lysis proteins.

Volume 1, Issue 5, Pages (September 2008)

Acquisition of global regulators during the evolution of streptomycetes. Acquisition of global regulators during the evolution of streptomycetes. The multilocus.

Unrooted neighbor-joining tree of 16S rRNA gene sequences from low-G+C-content gram-positive bacteria, obtained from clone libraries. Unrooted neighbor-joining.

(A and B) Maximum-likelihood trees of 28 strains of Pantoea agglomerans and closely related species, constructed using concatenated sequences of six protein-coding.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

0.005 E. billingiae Eb661 E. amylovora ACW5400 E. piriflorinigrans CFBP 5888T E. cloacae ATCC13047 P. ananatis AJ13355 P. ananatis PA13 P. ananatis LMG5342 P. ananatis BD442 P. ananatis B1-9 Chromosomal housekeeping protein-based phylogeny - AtpD, GyrB, InfB, RpoB Conserved plasmid/ICE protein-based phylogeny - 21 CDS 100 87 50 0.02 71 Figure S1 Phylogeny of ICEPan, ICEEclATCC13047, ICEEpiCFBP5888 and the plasmids pEb102 and pEI70 and comparison to chromosomal house-keeping marker phylogeny. Alignments of the concatenated amino acid sequences of 21 CDSs conserved in all five ICEPan, Enterobacter cloacae ICEEclATCC13047, Erwinia piriflorinigrans ICEEpiCFBP5888 as well as E. amylovora ATCC56400 pEI70 and E. billingiae Eb661 pEB102 were performed using MAFFT (Katoh and Standley, 2013). A phylogeny of the concatenated amino acid sequences of four house-keeping markers (AtpD, GyrB, InfB, and RpoB) was also performed. Phylogenies were constructed using MEGA v 5.2 (Tamura et al., 2011), using the Neighbour-joining algorithm with complete gap deletion, Poisson correction and bootstrap analysis (n = 1,000).

67 100 75 0.005 E. billingiae pEb102 E. amylovora pEI70 P. vagans C9-1 ICEPanAJ13355 ICEPanPA13 ICEPanLMG5342 ICEPanB1-9 Chromosomal housekeeping protein-based phylogeny - AtpD, GyrB, InfB, RpoB Conserved ICE umuDC island protein-based phylogeny - 11 CDS Figure S2 Phylogeny of ICEPan, plasmids pEb102 and pEI70 and P. vagans C9-1 chromosomal umuDC island and comparison to chromosomal house-keeping marker phylogeny. Alignments of the concatenated amino acid sequences of the 11 conversed CDSs encoded in the umuDC islands of ICEPanAJ13355, ICEPanB1-9, ICEPanLMG5342, ICEPanPA13, plasmids pEI70 and pEb102 and on the chromosome of P. vagans C9-1 were performed using (Katoh and Standley, 2013). A phylogeny of the concatenated amino acid sequences of four house-keeping markers (AtpD, GyrB, InfB, and RpoB) was also performed. Phylogenies were constructed using MEGA v 5.2 (Tamura et al., 2011), using the Neighbour-joining algorithm with complete gap deletion, Poisson correction and bootstrap analysis (n = 1,000).