Sequence and expression of Xenopus EAF2.

Slides:

Advertisements

Similar presentations

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Advertisements

Identification of vegetally localised vrtn transcripts.

The effect of amino acid substitution in the kinase inhibitory region of JAB. (A) Unchanged amino acids are shown as dots, substituted amino acids by a.

Zebrafish homolog of the leukemia gene CBFB: its expression during embryogenesis and its relationship to scland gata-1 in hematopoiesis by Trevor Blake,

SWP RNA expression pattern.

Phenotypes of GATA‐1.05/Y germline mutant embryos expressing wild‐type or mutant GATA‐1 transgenes. Phenotypes of GATA‐1.05/Y germline mutant embryos expressing.

Rab22A regulates melanocyte pigmentation, cargo transport and functions upstream of BLOC‐1 Rab22A regulates melanocyte pigmentation, cargo transport and.

John F. Golz, Emma J. Keck, Andrew Hudson Current Biology

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

The Drosophila Protein Dof Is Specifically Required for FGF Signaling

Sequence and comparison of the SDS protein.

Multiple sequence alignment of the BAR domains from Amphiphysins and from the subset of BAR domain family members that were shown to bind to a small GTPase.

Leslie Dunipace, Abbie Saunders, Hilary L. Ashe, Angelike Stathopoulos

Molecular cloning of Xenopus JNK1 and Xenopus MKK7.

Proinsulin effect on cardiac expression markers.

Malat1 is a neuron‐enriched nuclear‐retained ncRNA that is localized to nuclear speckles. Malat1 is a neuron‐enriched nuclear‐retained ncRNA that is localized.

Katherine Joubin, Claudio D Stern Cell

Characterization of Mouse Frizzled-3 Expression in Hair Follicle Development and Identification of the Human Homolog in Keratinocytes Betsy S. Hung,

Volume 94, Issue 3, Pages (August 1998)

Gabrielle Kardon, Brian D Harfe, Clifford J Tabin Developmental Cell

Volume 35, Issue 2, Pages (July 2002)

Distinct Origins of Adult and Embryonic Blood in Xenopus

Volume 6, Issue 6, Pages (June 1996)

Volume 16, Issue 12, Pages (June 2006)

Giant Eyes in Xenopus laevis by Overexpression of XOptx2

Volume 94, Issue 3, Pages (August 1998)

Expression of bnl in mesodermal bridge‐cells.

Act up Controls Actin Polymerization to Alter Cell Shape and Restrict Hedgehog Signaling in the Drosophila Eye Disc Aude Benlali, Irena Draskovic, Dennis.

Robert G. Kelly, Nigel A. Brown, Margaret E. Buckingham

John F. Golz, Emma J. Keck, Andrew Hudson Current Biology

Volume 86, Issue 3, Pages (August 1996)

HUA1 and HUA2 Are Two Members of the Floral Homeotic AGAMOUS Pathway

Drosophila fizzy-related Down-Regulates Mitotic Cyclins and Is Required for Cell Proliferation Arrest and Entry into Endocycles Stephan J Sigrist, Christian.

Identification of neurogenin, a Vertebrate Neuronal Determination Gene

Volume 1, Issue 1, Pages (July 2001)

Drosophila sickle Is a Novel grim-reaper Cell Death Activator

Neuropeptides: Developmental Signals in Placode Progenitor Formation

Single-Cell Transcript Analysis of Pancreas Development

The zebrafish pronephros: A model to study nephron segmentation

The Tec29 Tyrosine Kinase Is Required during Drosophila Embryogenesis and Interacts with Src64 in Ring Canal Development Erica M Roulier, Scott Panzer,

Volume 5, Issue 2, Pages (February 2000)

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Volume 4, Issue 4, Pages (April 2003)

Hiromi Shimojo, Toshiyuki Ohtsuka, Ryoichiro Kageyama Neuron

Volume 6, Issue 1, Pages (January 2004)

spitzIIT mutant SNS phenotype.

Whole‐mount in situ hybridization analysis of marker genes in wild‐type embryos and chokh mutants. Whole‐mount in situ hybridization analysis of marker.

A Novel Family of Mammalian Taste Receptors

Direct Pou5f1 and Pou5f1/Sox transcriptional targets have spatially restricted expression domains. Direct Pou5f1 and Pou5f1/Sox transcriptional targets.

Guidance Cues at the Drosophila CNS Midline: Identification and Characterization of Two Drosophila Netrin/UNC-6 Homologs Robin Harris, Laura Moore Sabatelli,

Analysis of GFP expression in gfp loss-of-function mutants.

Purification and identification of RECQ4 complex from human cells.

Re‐expression of the AXIN1 coding sequence re‐sensitizes VACO6R cells to PORCN inhibition Re‐expression of the AXIN1 coding sequence re‐sensitizes VACO6R.

DIA1(R1204X) induces elongated and thick microvilli in HeLa cells

Cerebellar midline fusion and variations in the expression of roof plate markers at the MHB junction. Cerebellar midline fusion and variations in the expression.

hb and pdm1, but not cas, are expressed in the NB7-3 lineage.

Pax2a and Pax8 are required for induction of otic cell fates.

XLMO-2 expression pattern in embryos.

Fig. 6. Differential effects of Lhx2 and Lhx5 on the OV and genetic interactions between Lhx1 and Lhx5.(A) Phylogenetic tree of chicken LIM-homeodomain.

prdm1a is co-expressed with foxd3 and tfap2a at the NPB

Volume 92, Issue 2, Pages (January 1998)

A Cyclin-Dependent Kinase Inhibitor, Dacapo, Is Necessary for Timely Exit from the Cell Cycle during Drosophila Embryogenesis Joriene C de Nooij, Mary.

Cell-autonomous migration of gata5/smarcd3b-expressing cells to the heart. Cell-autonomous migration of gata5/smarcd3b-expressing cells to the heart. (A-E)

A Bmp/Admp Regulatory Circuit Controls Maintenance and Regeneration of Dorsal- Ventral Polarity in Planarians Michael A. Gaviño, Peter W. Reddien Current.

Fig. 1. Lhx1 is expressed in the proximal region of the OV

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Diaphanous is present presynaptically and postsynaptically.

D. M. Hagan, A. J. Ross, T. Strachan, S. A. Lynch, V. Ruiz-Perez, Y. M

Volume 18, Issue 6, Pages (June 2010)

Presentation transcript:

Sequence and expression of Xenopus EAF2. Sequence and expression of Xenopus EAF2. (A) Xenopus EAF2 (xEAF2, GenBank Acc. # AJ579576) codes for a 250 amino‐acid protein with homologs in humans (hEAF2, GenBank Acc. # NP_060926) and mouse (mEAF2, GenBank Acc. # AAK59701). The amino‐acid identity between xEAF2 and hEAF2 and mEAF2 was calculated as 64 and 63%, respectively. Asterisks indicate conserved amino acids. (B) During Xenopus embryogenesis, EAF2 is expressed in the developing eye (arrowheads) as early as stage 18.5. (C) At stage 26, EAF2 expression is also detected in the pronephric tubule anlage (arrow) and faintly in the epiphysis (arrowhead). Dotted line indicates level of section shown in (D). (D) Transverse sections indicate that EAF2 is not expressed in the lens (arrowhead). (E–H) Wnt‐4 and EAF2 are co‐expressed in the pronephric anlage and in developing pronephric tubules. Wnt‐4 (E, G) and EAF2 (F, H) transcripts were detected by whole‐mount in situ hybridization. Embryos are shown in lateral views with anterior to the right and dorsal to the top. Insets show enlargements of the pronephric region. Wnt‐4 expression is present in the pronephric anlage (E, arrowhead) of a stage 23 embryo, whereas EAF2 expression is not yet detected at this stage (F). At stage 29/30, both Wnt‐4 (G) and EAF2 (H) are expressed in the pronephric tubule anlage. Daniel Maurus et al. EMBO J. 2005;24:1181-1191 © as stated in the article, figure or figure legend