Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. Heterologous processing of editing sites after.

Slides:

Advertisements

Similar presentations

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

Advertisements

Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.

Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.

PCB6528 Spring Exam 2 – Chase Name ____________________________ Page 1 of 4 1 [35 pt] In our discussion paper, Stegmann et al. (Proc. Natl. Acad.

Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.

Alternative Splicing. mRNA Splicing During RNA processing internal segments are removed from the transcript and the remaining segments spliced together.

From: Hepatitis B Virus Strains with Mutations in the Core Promoter in Patients with Fulminant Hepatitis Ann Intern Med. 1995;122(4): doi: /

Figure 1. RISC activity in BYL. ( A ) Quantity of AGO1 protein in BYL

Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.

Structures of CK1 inhibitors and their effects on CK1 activity in vitro. Structures of CK1 inhibitors and their effects on CK1 activity in vitro. (A) Structures.

Statistical analysis of transgene expression in pigs generated by lentiviral gene transfer. Statistical analysis of transgene expression in pigs generated.

Yuming Lu, Jian-Kang Zhu Molecular Plant

Reduced astrocyte proliferation results in increased immune cell infiltration into the injured GM Reduced astrocyte proliferation results in increased.

Transcribed strand breaks do not interfere with TFIIIB‐dependent recruitment of pol III to the promoter. Transcribed strand breaks do not interfere with.

Nur77 interacts with COUP‐TF in yeast.

Mitochondrial uptake of different DNA substrates.

Leaky scanning past the CPA1 and arg‐2 uORFs.

Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.

The cyclin B1 promoter is accessible to restriction endonucleases in vivo. The cyclin B1 promoter is accessible to restriction endonucleases in vivo. Nuclei.

Knockdown of Gsc and Vent1/2 restores normal development of dorsal and ventral half‐embryos (n=52 or more per experimental set). Knockdown of Gsc and Vent1/2.

Xer recombination at variant sites.

FtsK‐independent dif recombination in the presence of HinXerC.

The absence of Yca1 attenuates the apoptotic phenotypes of lsm4 mutants. The absence of Yca1 attenuates the apoptotic phenotypes of lsm4 mutants. (A) Wild‐type.

RNaseB was partially digested with subtilisin, yielding a preparation that contained undigested RNaseB and the faster migrating RNaseBS‐Prot (lane 1).

Measurement of terminal restriction fragments (TRFs) in bone marrow cells from both parents and the G4 progeny. Measurement of terminal restriction fragments.

Quiz#6 LC710 10/13/10 name___________

Morphological analyses of peripheral blood and bone marrow cells isolated from leukemic mice. Morphological analyses of peripheral blood and bone marrow.

Double‐stranded RNA binding of NS3 is required for HIV‐1 Tat complementation. Double‐stranded RNA binding of NS3 is required for HIV‐1 Tat complementation.

Motif detectability corresponds to the phylogenetic profile of the cognate transcription factor. Motif detectability corresponds to the phylogenetic profile.

Overexpression of RNase H1 decreases the induction of phosphorylated H2AX in post‐mitotic cells in response to topoisomerase 1 cleavage complexes. Overexpression.

Sequence and comparison of the SDS protein.

Consequences of T‐DNA insertion on SWP expression in swp mutant.

Non‐specific activation of gene transcription by exogenous Fe65 in luciferase‐based reporter assays. Non‐specific activation of gene transcription by exogenous.

NM1 localizes in nucleoli and is required for Pol I transcription.

Proinsulin effect on cardiac expression markers.

Volume 14, Issue 5, Pages (March 2004)

Dual role of DRD1 in the dynamic regulation of RNA‐directed DNA methylation. Dual role of DRD1 in the dynamic regulation of RNA‐directed DNA methylation.

Basal autophagic flux and peroxisome abundance are not affected in USP30 KO cells Basal autophagic flux and peroxisome abundance are not affected in USP30.

Structure of in‐frame deletions.

RNA charging levels before and after starvation.

Both NM1 and the WSTF complex stimulate Pol I transcription.

Albino phenotype and reduced cpDNA copy number in cptk1 plants.

Mutations in the Liver Glycogen Phosphorylase Gene (PYGL) Underlying Glycogenosis Type VI (Hers Disease) Barbara Burwinkel, Henk D. Bakker, Eliezer Herschkovitz,

nramp2 Mutants Are Hypersensitive to Mn Deficiency.

Analysis of WHITE COLLAR 2 isoforms.

Functional miR‐33 responsive elements in the 3′UTR of ATP8B1 and ABCB11.A,B.Conserved sequences in the 3′UTR of ATP8B1 and ABCB11 are partially complementary.

Figure Pedigree of the family

Psoriasis Upregulated Phorbolin-1 Shares Structural but not Functional Similarity to the mRNA-Editing Protein Apobec-1 Peder Madsen, Julio E. Celis,

Quiz#6 LC710 10/13/10 name___________

Anaphase chromosome separation in extracts takes place in the absence of intact spindle poles. Anaphase chromosome separation in extracts takes place in.

Chromatin regulation upon recruitment of HOTAIR

Genotype/Phenotype Analysis of a Photoreceptor-Specific ATP-Binding Cassette Transporter Gene, ABCR, in Stargardt Disease Richard Alan Lewis, Noah F.

Mechanism of Triton binding to ShHTL7

Mapping of small RNAs to LINE‐1 sequence (related to Figs 3 and 4)‏

Example of processed data visualized with “Peak Browser” of ChIP‐Atlas

Loss of ANAC032 increases disease susceptibility to Pst DC3000

Volume 11, Issue 6, Pages (March 2001)

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Subnetworks enriched for the hallmarks of cancer.

Volume 10, Issue 1, Pages (January 2017)

Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment.

Loss of tight junctions on Rac1 activation in mature cysts.

Opitz G/BBB Syndrome in Xp22: Mutations in the MID1 Gene Cluster in the Carboxy- Terminal Domain Karin Gaudenz, Erich Roessler, Nandita Quaderi, Brunella.

The antitumor activity of olaparib in PDXs identifies a subset of PARPi‐sensitive tumors The antitumor activity of olaparib in PDXs identifies a subset.

Specific Effects of MicroRNAs on the Plant Transcriptome

Volume 57, Issue 3, Pages (March 2000)

Effect of rare SVs on cardiac transcription in DCM

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Figure Pedigree, images, and mutation analysis of the neuroferritinopathy family Pedigree, images, and mutation analysis of the neuroferritinopathy family.

Knock-in of the rpl42-P56Q mutation using the split-ura4 system.

Presentation transcript:

Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. Heterologous processing of editing sites after somatic or sexual transfer into a foreign genetic background. (A) Editing of ndhD‐293 in Nicotiana glutinosa, Nicotiana tabacum Petit Havanna and the introgression line N. tabacum Samsoun (NN). Excerpts of the sequencing chromatograms are shown, with the edited position marked by an asterisk and the affected codon boxed. Phenotypes of mature plants are shown, with the inset showing the different flower morphologies. Circles indicate the nuclei and ovals the plastids. Nt, N. tabacum Petit Havanna; Ng, N. glutinosa. Superscript N indicates the presence of the N‐gene conferring resistance against tobacco mosaic virus. (B) Complementary DNA sequence analysis of editing sites ndhA‐189 and ndhD‐293 in nightshade Ab(Ab) and cybrid Nt(Ab) seedlings. Relevant chromatogram excerpts are shown, with the edited position and codons marked as in (A). (C) Nicotiana tomentosiformis possesses and processes editing site ndhD‐293, whereas this site is absent in Nicotiana sylvestris and N. tabacum. Partial ndhD DNA sequences for the three Nicotiana species are aligned. Below is an excerpt of a cDNA sequence from N. tomentosiformis together with the corresponding chromatogram. Editing sites and affected codons are marked as in (A). Michael Tillich et al. EMBO Rep. 2006;7:308-313 © as stated in the article, figure or figure legend