Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.

Slides:

Advertisements

Similar presentations

Whats your favorite color? a pear a green pear.

Advertisements

The Build-up of the Red Sequence at z

Class I-A Class II-A Class II-B Class II- Basal Class I-B Class I Class II 0.1 Arabidopsis thaliana PHO1;H2 Capsella rubella PHO1;H Thellungiella.

Supplementary figure S3. Diagram showing the effects of removing data from particular organ types on the relative percentage of gene pairs showing reciprocal.

COLORING WITH NUMBERS. NumbersNumbers NumbersNumbers

SNC2D. Primary LIGHT colours are red, green, and blue SECONDARY light colours are created by combining only two of the three primary colours of light.

Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.

Figure S1 AtFTComFT2HGtFT1GtFT2 A. thaliana ( 29 dpi ) PsFTa1GtFT1InFT1 H PsFTa1 GtFT1 InFT1 H GtFT2 Tobacco ‘Xanthi nc’ (55 dpi) (86 dpi) (108 dpi) Figure.

Cluster I. Cluster II Cluster III (contiued) Cluster IV.

If you say 8 color the ones in your picture purple. If you say 9 color the ones in your picture blue.

Spring Colors Enter our Garden to see all of the beautiful flowers that bloom in the Spring time.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

Supporting Fig. S1 OsRHR-GFP GFP ChlorophyllMerge GC Hoechst Merge GH Supporting Figure S1. The OsPHR-GFP fusion protein localizes to nuclei, chloroplasts,

Seeing in colour Stare at the coloured dot in the middle of the next picture for a minute. Then describe what you see when you look at the next slide.

Crazy colors By teacher john. Basic colors! White Black red blue Light green yellow orange purple Grey Light blue green.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Volume 2, Issue 5, Pages (September 2009)

Volume 12, Issue 6, Pages (June 2005)

a. ZEP ZEP Os04g Selmo Phypa Chlre CTF2B

Seeing in colour Stare at the coloured dot in the middle of the next picture for a minute. Then describe what you see when you look at the next slide.

Figure S2. Sequence alignment of GSI-like portion of Arabidopsis NodGS polypeptide with GSI-like part of FluG from Aspergillus nidulans, GSI-like protein.

Volume 6, Issue 3, Pages (May 2013)

Kazimierz T. Tycowski, Mei-Di Shu, Joan A. Steitz Cell Reports

The Role of Recently Derived FT Paralogs in Sunflower Domestication

Name: _______________________________

Average Number of Photons

Sequence and comparison of the SDS protein.

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Multiple sequence alignment and analysis of SOFL proteins.

Closing the gap on DNA ligase

Volume 10, Issue 1, Pages (January 2017)

Two ways to discuss color 1) Addition 2) Subtraction

Transcription: Identification of a prime suspect

Can I color yellow?. Can I color yellow?

Volume 26, Issue 5, Pages (June 2007)

Volume 10, Issue 6, Pages (June 2017)

Volume 12, Issue 6, Pages (June 2005)

Volume 14, Issue 12, Pages (December 2006)

How Many Colorful Shapes?

Volume 8, Issue 8, Pages (August 2015)

Speedy Grass Stomata: Emerging Molecular and Evolutionary Features

Amanda Ooi, Fouad Lemtiri-Chlieh, Aloysius Wong, Christoph Gehring

What Color is it?.

Evolutionary History of the Non-Specific Lipid Transfer Proteins

C c Cc is for cat. © ©

Volume 133, Issue 1, Pages (April 2008)

Yusuke Nakasone, Kazunori Zikihara, Satoru Tokutomi, Masahide Terazima

Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.

Linking transcriptional mediators via the GACKIX domain super family

Replica Exchange Molecular Dynamics Simulations Provide Insight into Substrate Recognition by Small Heat Shock Proteins Sunita Patel, Elizabeth Vierling,

Crystal Structure of Saccharopine Reductase from Magnaporthe grisea, an Enzyme of the α-Aminoadipate Pathway of Lysine Biosynthesis Eva Johansson, James.

Created for CVCA Physics by Dick Heckathorn 31 May 2K+4

Created for CVCA Physics by Dick Heckathorn 31 May 2K+4

Help Gina and Tina color the numbers

Gregory J. Miller, James H. Hurley Molecular Cell

Ramon Hurtado-Guerrero, Daan M.F. van Aalten Chemistry & Biology

PtrHB7, a class III HD-Zip Gene, Plays a Critical Role in Regulation of Vascular Cambium Differentiation in Populus Yingying Zhu, Dongliang Song, Jiayan.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Alignment of the fast/developmental and IIM MYH genes.

Let’s Learn the Basic Colors

Sequence comparisons of fungal HOG1 orthologues.

Sequence alignments of phage‐type RNA polymerases and lysozymes

OsELF3 Is Involved in Circadian Clock Regulation for Promoting Flowering under Long- Day Conditions in Rice Ying Yang, Qiang Peng, Guo-Xing Chen, Xiang-Hua.

Subcellular Localization of At4g19010

Functional Insights of Plant GSK3-like Kinases: Multi-Taskers in Diverse Cellular Signal Transduction Pathways Ji-Hyun Youn, Tae-Wuk Kim Molecular Plant

Volume 2, Issue 6, Pages (November 2009)

Volume 3, Issue 2, Pages (March 2010)

Presentation transcript:

Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus communis (Rco), Vitis vinifera (Vvi), Arabidopsis thaliana (Ath), Oryza sativa (Osa), Physcomitrella patens (Ppa), Aspergillus nidulans (Ani), and Ajellomyces capsulatus (Aca). ). The chemical nature of the individual amino acids is color-coded as follows: cyan, W,F,V,Y,L,I,H,M,A; orange, G; yellow, P; magenta, D,E; green, N,S,T,Q; red, R,K; pink, C. Identical amino acids are marked with asterisk, conserved substitutions are marked with colon, and semi-conserved substitutions are marked with dot.