Tositumomab (DB00081) Approved Drug

Slides:



Advertisements
Similar presentations
Frank P. Dawry.
Advertisements

Delivery Of Proteins: Target Site-specific Delivery By The Parenteral Route Saeb Aliwaini1.
(Approved investigational)
Denileukin diftitox Drugbank ID : DB00004 Chemical formula :
Adalimumab Drugbank ID : DB00051
Anti-thymocyte Globulin (Equine)
Follitropin beta (DB00066) Approved Drug
Omalizumab Drugbank ID : DB00043
Menotropins Drugbank ID : DB00032
Brodalumab Drugbank ID : DB11776 Molecular Weight (Daltons) :144,000
Certolizumab pegol DB08904 C2115H3252N556O673S16 91 kDa CATEGORY
Darbepoetin alfa Drugbank ID : DB
Peginterferon alfa-2a Drugbank ID : DB00008
Interferon alfa-n1 Drugbank ID : DB00011
Reteplase Drugbank ID : DB00015
Necitumumab Drugbank ID :DB09559 Molecular Weight (Daltons) :144800
Anti-thymocyte Globulin (Rabbit)
Dulaglutide Drugbank ID : DB09045.
Epoetin alfa Drugbank ID : DB00016
Elotuzumab Drugbank ID : DB06317.
Campos M et al. Proc EHA 2013;Abstract B2009.
DB08870 Brentuximab vedotin C6476H9930N1690O2030S –151.8 kDa.
TALIGLUCERASE ALFA DB08876 C2580H3918N680O727S g/mol
Campos M et al. Proc EHA 2013;Abstract B2009.
Subcutaneous injection
Alemtuzumab (DB00087) Approved and Investigational Drug
Palifermin Drugbank ID : DB00039
ID DB08935 OBINUTUZUMAB C6512H10060N1712O2020S kDa CATEGORY
Pegvisomant(DB00082) Approved Drug
Human Serum Albumin (DB00062) Approved Drug
Ramucirumab Protein chemical formula : C6374H9864N1692O1996S46
Metreleptin Drugbank ID :DB09046
Peginterferon beta-1a Drugbank ID :DB00060
Asfotase Alfa Drugbank ID : DB09105.
Insulin, porcine (DB00071) Approved Drug
Muromonab (DB00075) Approved and Investigational Drug
Insulin Degludec Drugbank ID :DB09564
Salmon Calcitonin Drugbank ID : DB00017
Nivolumab Drugbank ID : DB09035 Molecular Weight (Daltons) :
RAXIBACUMAB DB08902 C6320H9794N1702O1998S kDa CATEGORY
DB08879 BELIMUMAB C 6358 H 9904 N 1728 O 2010 S kDa CATEGORY Monoclonal antibodies.
Drugbank ID : DB00005 Half life : 102 +/- 30 hrs
Serum Albumin Iodinated(DB00064) Approved Drug
Evolocumab Drugbank ID : DB09303.
Pembrolizumab Drugbank ID :DB09037 Half life : 28 days.
Streptokinase (DB00086) Approved Drug
Natalizumab (Approved, Investigational)
Cetuximab Drugbank ID : DB00002
Daratumumab Drugbank ID : DB09043.
Vedolizumab Protein chemical formula : C6528H10072N1732O2042S42
Interferon alfacon-1 (DB00069) Approved Drug
Pegfilgrastim Drugbank ID : DB00019
Imiglucerase Protein chemical formula : C2532H3854N672O711S16
Ofatumumab Drugbank ID : DB06650 Molecular Weight (Daltons) :146100
Atezolizumab Drugbank ID : DB11595.
Galsulfase (Approved investigational) DB01279
Monoclonal Antibodies
Asparaginase Drugbank ID : DB00023
Basiliximab (DB00074) Approved and Investigational Drug
Idarucizumab Molecular Weight (Daltons) : 47766
Ibritumomab(DB00078) Approved Drug
Globular Protein Made of amino acid chains
Thyrotropin Alfa Drugbank ID : DB00024
Rituximab (DB00073) Approved Drug
Pegademase bovine Drugbank ID : DB00061
Ixekizumab Drugbank ID : DB11569 Molecular Weight (Daltons) :146,158
Eptifibatide (DB00063) Approved and Investigational Drug
Natural alpha interferon (DB05258) Approved and Investigational Drug
DB00090  Laronidase C3160H4848N898O881S kDa IV infusion.
Obiltoxaximab Drugbank ID :DB05336 Molecular Weight (Daltons) :148000
Presentation transcript:

Tositumomab (DB00081) Approved Drug Chemical Formula: C6416H9874N1688O1987S44 Molecular Weight: 143859.7 Murine IgG2a lambda monoclonal antibody against CD20 antigen (2 heavy chains of 451 residues, 2 lambda chains of 220 residues). It is produced in an antibiotic-free culture of mammalian cells. It can be covalently linked to Iodine 131 (a radioactive isotope of iodine). Indication/Usage For treatment of non-Hodgkin's lymphoma (CD20 positive, follicular) Pharmacodynamics Tositumomab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells. Mechanism of Action Binds to the CD20 antigen which is found on mature B lymphocytes. The antibody binding appears to induce apoptosis, complement-dependent cytotoxicity and cell death through ionizing radiation.

Metabolism Half Life Route of Elimination Clearence Drug Interactions Most likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production Half Life 0.8 hours (mammalian reticulocytes, in vitro) Route of Elimination Elimination of Iodine-131 occurs by decay and excretion in the urine. Clearence * 68.2 mg/hr [patients with NHL] Drug Interactions DB00108 (Natalizumab): The immunosuppressant, Tositumomab, may increase the adverse effects of Natalizumab. Increased risk of Progressive Multifocal Leukoencephalopathy (PML) and other infections. Concurrent therapy should be avoided. DB00072 (Trastuzumab): Trastuzumab may increase the risk of neutropenia and anemia. Monitor closely for signs and symptoms of adverse events. Sequence Heavy chain 1: QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Experimental Properties Light chain 1: QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPARFSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR Heavy Chain 2: QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Light chain 2: Experimental Properties Melting Point: 61 °C (FAB fragment), 71 °C (whole mAb) Hydrophobicity: -0.4144 Isoelectric Point: 8.68 Affected Organisms Human and other Mammals

Targets B-lymphocyte antigen CD20,Low affinity immunoglobulin gamma Fc region receptor III-B,Complement C1r subcomponent,Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit B,Complement C1q subcomponent subunit C,Low affinity immunoglobulin gamma Fc region receptor III-A,High affinity immunoglobulin gamma Fc receptor I,Low affinity immunoglobulin gamma Fc region receptor II-a,Low affinity immunoglobulin gamma Fc region receptor II-b,Low affinity immunoglobulin gamma Fc region receptor II-c Brands Bexxar - Galaxo Smith Kline

Bexxar Formulation Used/Prescribed for Dosage Contraindications The BEXXAR therapeutic regimen is composed of the monoclonal antibody tositumomab, and the radio labeled monoclonal antibody, I-131 tositumomab. Tositumomab is supplied as a sterile, pyrogen-free, clear to opalescent, colorless to slightly yellow, preservative-free solution for intravenous administration Formulation The formulation contains 100 mg/mL maltose, 8.5 mg/mL sodium chloride, 1 mg/mL phosphate, 1 mg/mL potassium hydroxide, and Water for Injection, USP. The pH is approximately 7.2. Used/Prescribed for The BEXXAR therapeutic regimen (Tositumomab and Iodine I 131 Tositumomab) is indicated for the treatment of patients with CD20 antigen-expressing relapsed or refractory, low grade, follicular, or transformed non-Hodgkin's lymphoma, including patients with Rituximab-refractory non-Hodgkin’s lymphoma. Determination of the effectiveness of the BEXXAR therapeutic regimen is based on overall response rates in patients whose disease is refractory to chemotherapy alone or to chemotherapy and Rituximab. The effects of the BEXXAR therapeutic regimen on survival are not known. Dosage The BEXXAR therapeutic regimen consists of 2 separate components (tositumomab and iodine I 131 tositumomab) administered in 2 separate steps (dosimetric dose and therapeutic dose) separated by 7 to 14 days.Tositumomab 450 mg by intravenous infusion.I-131 tositumomab (5 mCi I-131 and 35 mg protein) by intravenous infusion Contraindications The BEXXAR therapeutic regimen is contraindicated in patients with known hypersensitivity to murine proteins or any other component of the BEXXAR therapeutic regimen

Side- effects Drug Interactions References Serious Allergic Reactions, Including Anaphylaxis, Prolonged and Severe Cytopenias, Secondary malignancies, Hypothyroidism, neutropenia, thrombocytopenia, anemia, infections (including pneumonia, bacteremia, septicemia, bronchitis, and skin infections), infusion reactions, asthenia, fever, and nausea Drug Interactions No formal drug-drug interaction studies have been conducted with tositumomab or I-131 tositumomab. References http://dailymed.nlm.nih.gov/dailymed/archives/fdaDrugInfo.cfm?archiveid=11680 http://www.rxlist.com/bexxar-drug.htm