Phylogenetic relationships amongst HEV strains

Slides:

Advertisements

Similar presentations

Human rhinovirus species occurrence among adults with respiratory tract infection and asymptomatic individuals during two consecutive winter seasons Zlateva.

Advertisements

Hepatitis A Last updated August Hepatitis A virus Associated with poor hygiene and sanitation - primarily transmitted from person-to-person via.

Hepatitis A and Hepatitis A Vaccine Epidemiology and Prevention of Vaccine- Preventable Diseases National Immunization Program Centers for Disease Control.

Controlling the risk of Chikungunya

HEV in Belgium: An import infection or an emerging viral zoonosis? I.Micalessi, I.Thomas, B. Brochier National Center of Viral Hepatitis Rue Juliette Wytsmanstraat.

Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine.

Hepatitis E - Clinical Features Incubation period:Average 40 days Range days Case-fatality rate:Overall, 1%-3% Pregnant women, 15%-25% Illness severity:Increased.

Bioinformatics and Phylogenetic Analysis

 Primary liver cancer is the fifth most common cancer in the world and the third most common cause of cancer mortality  Hepatocellular carcinomas (HCCs)

PHYLOGENETIC ANALYSIS OF A NEW GROUP OF CUCUMBER MOSAIC VIRUS ISOLATES BASED ON 2B GENE SEQUENCING Nesmelov I.B., Gnutova R.V., Tolkach V.Ph.

Viral Hepatitis A “Infectious” “Serum” Viral hepatitis Enterically transmitted Parenterally transmitted F, G, ? other E NANB BD C.

(+) Stranded RNA Viruses III

Division of Viral Hepatitis

Hepatitis C Virus  Genome resembled that of a flavivirus positive stranded RNA genome of around 10,000 bases  1 single reading frame, structural genes.

What do you need to know? Are you at risk? How do you protect yourself? SWINE FLU Partnership for Environmental Education and Rural Health peer.tamu.edu.

1 Foodborne & Waterborne Disease Viruses Suphachai Nuanualsuwan DVM, MPVM, PhD 3. Hepatitis viruses.

Enabling Multiple Sequence Comparison by Log- Expectation (MUSCLE) on EUAsiaGrid EUAsiaGrid Master Class 6 May 2010 By: Lee Hong Kai and Thomas Tay NUHS.

Basic Local Alignment Search Tool BLAST Why Use BLAST?

Database search. Overview ： 1. FastA ： is suitable for protein sequence searching 2. BLAST ： is suitable for DNA, RNA, protein sequence searching.

David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.

HBV genotypes E and A deletions and recombination: two sides of the same coin? Penelope Garmiri 1, Andre Loua 2, Daniel Candotti 3 and Jean-Pierre Allain.

Jelena Prpić, B.Sc., PhD Croatian Veterinary Institute.

Bifx Africa-India Joint Virtual Conference 2011 Bioinformatics for the analysis of hepatitis B virus HBV in pregnant women Silvia Vasquez 1, Howard Fields.

1 Recent Global Development of Two Major Porcine Diseases - African Swine Fever and Porcine Epidemic Diarrhea - Dr Tomoko ISHIBASHI Deputy Regional Representative.

What is BLAST? Basic BLAST search What is BLAST?

Ch Epidemiology Microbiology.

Epidemiology of Hepatitis A in Ireland Last updated March 2017

How dangerous are Donor Travels?

Evolution of rubella viruses following long term endemic circulation

Hepatitis A-E Viruses An Overview.

Use of next generation Sequencing (NGS) at a National Reference Laboratory, Denmark 2015/16 Authors: Thea Kølsen Fischer, Ramona Trebbien, Jannik Fonager,

Prevalence of Hepatitis C Virus Genotypes in Bangladesh

Hepatitis and Liver Diseases

Basics of BLAST Basic BLAST Search - What is BLAST?

Copyright © 2017 American Academy of Pediatrics.

BLAST Anders Gorm Pedersen & Rasmus Wernersson.

Asst. Prof. Dr. Dalya Basil Hanna

Dr. Mohd. Shaker An Overview

Welcome to Introduction to Bioinformatics

gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)

Molecular epidemics of Norovirus related Outbreak in Korea

Controlling the risk of Chikungunya

Dengue Virus Infections Investigation Guideline

Dr Paul T Francis, MD Community Medicine College of Medicine, Zawia

Accurate genotyping of hepatitis C virus through nucleotide sequencing and identification of new HCV subtypes in China population Y.-Q. Tong, B. Liu,

Phase 3 Treatment-Naïve and Treatment-Experienced

Division of Viral Hepatitis

Volume 130, Issue 3, Pages (March 2006)

HEPATITIS C BY MBBSPPT.COM

Hepatitis E: An emerging awareness of an old disease

J. Lu, H. Zeng, H. Zheng, L. Yi, X. Guo, L. Liu, L. Sun, X. Tan, H

Basic Local Alignment Search Tool

Accurate genotyping of hepatitis C virus through nucleotide sequencing and identification of new HCV subtypes in China population Y.-Q. Tong, B. Liu,

L. Dubourg Clinical Microbiology and Infection

Comprehensive analysis of mutations in the hepatitis delta virus genome based on full- length sequencing in a nationwide cohort study and evolutionary.

Epidemiological and virological characteristics of symptomatic acute hepatitis E in Greater Cairo, Egypt E. Delarocque-Astagneau, F. Abravanel, A. Moshen,

Tracking the naturally occurring mutations across the full-length genome of hepatitis B virus of genotype D in different phases of chronic e-antigen-negative.

Hepatitis E virus as a newly identified cause of acute viral hepatitis during human immunodeficiency virus infection P. Colson, C. Dhiver, R. Gérolami

Multiple genotypes and subtypes of hepatitis B and C viruses in Belarus: similarities with Russia and western European influences C.M. Olinger, N.V.

Amplification and pyrosequencing of near-full-length hepatitis C virus for typing and monitoring antiviral resistant strains P. Trémeaux, A. Caporossi,

Human infection with novel G3P[25] rotavirus strain in Taiwan

Epidemiology of hepatitis A in Ireland

Sequence alignment, E-value & Extreme value distribution

Molecular epidemiology of hepatitis B virus in Iran

Comprehensive analysis of mutations in the hepatitis delta virus genome based on full- length sequencing in a nationwide cohort study and evolutionary.

Additional file 3 >HWI-EAS344:7:70:153:1969#0/1 Length = 75

Volume 70, Issue 5, Pages (May 2019)

Varicella Vaccine Efficacy Estimates

Presentation transcript:

Phylogenetic relationships amongst HEV strains Participants: Agnes Zotter Lambert Motilal Maria Montalvo Marissa Moses Robin Antoine

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Hepatitis E Virus Hepeviridae, Hepevirus genus Unenveloped RNA virus, 27-34nm in diameter +ve stranded RNA genome, 7.2 kb in size Very labile and sensitive UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Epidemiologic Features Hepatitis E - Epidemiologic Features Most outbreaks associated with faeceally contaminated drinking water. Large epidemics have occurred in the Indian subcontinent, USSR, China, Africa and Mexico. In the United States and other non-endemic areas, where there are no documented outbreaks of hepatitis E, a low prevalence of anti-HEV (<2%) has been found in healthy populations. The source of infection for these persons is unknown. Minimal person-to-person transmission. UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. 29 29 29

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Hepatitis E - Clinical Features Incubation period: Average 40 days Range 15-60 days Case-fatality rate: Overall, 1%-3% Pregnant women, 15%-25% Illness severity: Increased with age Chronic sequelae: None identified UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. 27 27 27

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Hepatitis E Virus Genome HEV isolates have been grouped into four genotypes (1 to 4) Genotype 1 groups isolates found mainly in Asia and Africa Genotype 2 contains an isolate from an outbreak in Mexico and Africa Genotype 3 groups isolates found in the US & Europe Genotype 4 groups isolates found in China, Taiwan and Japan UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Research question To determine the genotype identity of isolates found in Cuba Possible ways of managing the disease UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Methods: Sequences from RNA polymerase in GenBanK (NCBI) 13 hits CUB9-1999 isolate chosen (241 bp linear RNA) Blastn: 30 entries chosen/E-value Length +/- 10 nucleotides alignment UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Blastp Protein ID from initial selected isolate >gb|ACD39863.1| RNA-dependent RNA polymerase [Hepatitis E virus] Length=116 Score = 133 bits (334), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%) Query 1 CALFGPWFRAIEKAILALLPQGVFYGDAFDDTVFSATVAAAKASMVFENDFSEFDSTQNN 60 CALFGPWFRAIEK ILALLP +FYGDA++++VFSA ++ A +SMVFENDFSE ST NN Sbjct 9 CALFGPWFRAIEKE ILALLPPN IFYGDAYEES VFSAAISGAGSSMVFENDFSEDXSTLNN 68 Query 61 FSLGLECAIMEECGMPQWL 79 FSLGLEC IMEECGMPQWL Sbjct 69 FSLGLECVIMEECGMPQWL 87 ClustalX2 multiple alignment Analysis in Phylogenetic software UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Protein alignment (MSA): UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Results: R Nucleic Acids Research 2005 33(Web Server Issue):W553-W556; doi:10.1093/nar/gki494 . C-Y Lin*, F-K Lin, CH Lin, L-W Lai, H-J Hsu, S-H Chen and CA Hsiung http://power.nhri.org.tw/ UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Phylogenetic tree: Genotype 4 DNA data NJ analysis Genotype 2 Genotype 3 Genotype 1 UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Protein Seq. data Phylogenetic tree NJ analysis UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Phylogenetic tree: Phylip with DNA data JAP291 Cub25_08 Mex017 Fin969 Fin973 Ind LonInd097 Mor494 Chn001 Chn363 Ind103 Chn457 Hyder Cub19_99 Cub9_99 Nind Cub2_05 Cub27_99 Cub10_99 Fin971 Fin967 US2 SKor476 US1 SKor466 Fr757 Fr719 Fr767 Fr787 Fr785 UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Phylogenetic tree: Phylip/protein data UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

DNA Alignment without Cub25-2008 UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Phylogenetic tree: MEGA4/DNA data Genotype 1 Genotype 2 Genotype 4 Genotype 3 UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Phylogenetic tree: MEGA/protein data Genotype 1 Genotype 2 Genotype 4 Genotype 3 UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. Conclusion HEV from human in Cuba were clustered in at least two genotypes. Genotype 1 with Asian and African isolates Genotype 3 with American and European isolates from swine and human UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

UWI, St. Augustine, Trinidad & Tobago, 29.01.2010. A take-home message… Avoid drinking water (and beverages with ice) of unknown purity, uncooked shellfish, and uncooked fruit/vegetables not peeled or prepared by traveler. IG prepared from donors in Western countries does not prevent infection. Unknown efficacy of IG prepared from donors in endemic areas. Vaccine? UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.

Thank you for your attention! Special thanks for the great teachers, who were very patient and helpful, who helped us to make this presentation better… Dr. Urmila Kulkarni-Kale Dr. Jessica Kissinger Dr. Dinesh Gupta Dr. Arnab Pain Dr. Vrijesh Tripathi UWI, St. Augustine, Trinidad & Tobago, 29.01.2010.