Quiz#3 LC710 10/17/12 name____________ Q1(4%)

Slides:

Advertisements

Similar presentations

Protein Synthesis $100 $200 $300 $400 $500 $100$100$100 $200 $300 $400 $500 Central Dogma Basics Transcription RNA Mutations FINAL ROUND Translation.

Advertisements

Quiz By: Steven Hancock Click START to begin the quiz. ALGEBRA.

KEY WORDS – CELLS, DNA, INFORMATION All living things are made from Deoxyribonucleic acid is abbreviated This molecule stores that helps cells carry.

Transcription Transcription is the synthesis of mRNA from a section of DNA. Transcription of a gene starts from a region of DNA known as the promoter.

Test Your Knowledge. x + 3 =6 a.5 b.4 c.3 d.2 y - 11= 78 a. 69 b. 89 c. 87 d. 68.

Protein Synthesis 12-3.

Unit 6: DNA Grab a new Warm Up!. Monday 4/13 Learning Targets: 1) I can work with my lab team to create a presentation of my experimental research. 2)

Protein synthesis pt 2: Translation. MRNA strand exits the nucleus and attaches itself to a ribosome The initiator codon turns on protein synthesis Sequence.

Protein Synthesis How to code for the correct amino acids.

SC.912.L.16.5 Protein Synthesis: Transcription and Translation.

DNA & Protein Synthesis Learning Target: Identify which key ideas about DNA and protein synthesis you still need to understand better.

BELLRINGER: Draw the following box and fill in the squares, THIRD box on the last bell-ringer page: REPLICATIONTRANSCRIPTION Where in the cell.

By drawing a picture describe the flow of genetic information from DNA to a protein.

Amino Acid Structure From DNA a strand of mRNA is transcribed. This mRNA is read by a ribosome in the cytoplasm which in turn constructs the appropriate.

Friday Quiz Details! Part One-Geography You will have to correctly identify places and features of US and NC map. Part 2: Key terms.

Eukaryotic Gene Structure. 2 Terminology Genome – entire genetic material of an individual Transcriptome – set of transcribed sequences Proteome – set.

Use Flowchart modeling to design and create an interactive quiz to be run on Powerpoint. Start Question Click to start the quiz Correct Incorrect, try.

Translation Section 11-2 cont.. Transcription Translation 20 different amino acids 20 different amino acids A group of three nucleotides in mRNA code.

The Genetic Code. The DNA that makes up the human genome can be subdivided into information bytes called genes. Each gene encodes a unique protein that.

Protein Synthesis. The genetic code This is the sequence of bases along the DNA molecule Read in 3 letter words (Triplet) Each triplet codes for a different.

Question #1 DNA and RNA nucleotides differ in their ___. Write in ALL that apply. a) Phosphate groups b) Nitrogenous bases c) Sugars d) Functions.

Quiz About Your Topic Question 1 A question about your topic: A. [Insert incorrect answer] C. [Insert incorrect answer] B. [Insert incorrect answer]

THE THREE TYPES OF RNA. Section 11.2 Summary – pages There are three main types of RNA that help build proteins. # 1 Messenger RNA (mRNA) brings.

Translation: The 3 rd Tenet Of the Central Dogma.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Chapter 11 Chapter Pre-view

Enzymes Worksheet catalyst amino acids different function

Variation among organisms

Quiz#3 LC710 9/29/10 name____________

Protein Synthesis-How do we go from genotype to phenotype

(3) Gene Expression Gene Expression (A) What is Gene Expression?

Jump Start Answer the following in your journal:

Chapter 21 Nucleic Acids and Protein Synthesis

Lesson starter Name the four bases found in DNA

Quiz About [Your topic]

Transcription & Translation.

Quiz#7 LC710 10/18/10 name___________

Sequence analyses and evolutionary conservation of the CLDN10 gene and the identified CLDN10 variants. Sequence analyses and evolutionary conservation.

(A) Schematic representation of kalata B1 showing the cyclic cystine knot, the amino acid sequence in single letter code, and the regions used for oligonucleotide.

Bell ringer-General December 9, 2015

Protein Synthesis Step 2: Translation

Quiz#4 LC710 11/14/11 name___________

Section: ___ Time of lab:______8th or 9th floor (circle)

Essential Question: How cells make proteins

Volume 84, Issue 3, Pages (February 1996)

RNA DNA Synthesis Mutations Protein Synthesis

Quiz#1 LC710 10/10/12 name____________

Quiz#4 LC710 10/04/10 name___________

Distinguish between codon and anticodon.

Volume 117, Issue 3, Pages (September 1999)

Protein Synthesis.

Steps to Protein Synthesis

RNA DNA Synthesis Mutations Protein Synthesis

Protein Synthesis.

Quiz#1a LC710 11/05/17 name____________

Shyam S. Jayaraman, David J. Rayhan, Salar Hazany, Michael S. Kolodney

BLAT Blast Like Alignment Tool

Gene Expression Practice Test

Part 1: Short Answer Quiz 2: Biol Name:_______________

Where would you draw the polyA tail in the gene above?______________

Bioinformatics 김유환, 문현구, 정태진, 정승우.

Friday March 27, 2015 Day 1 1. Please have these Items on your desk.

Schematic drawing of alternatively-spliced GFP reporter gene.

Transcription & Translation

iraL shares sequence identity with iraM from E

Amino acids are coded by mRNA base sequences.

Prokaryotes Eukaryotes

Volume 97, Issue 6, Pages (June 1999)

A, Schematic diagram of identified splice variants of PD-L1.

Presentation transcript:

Quiz#3 LC710 10/17/12 name____________ Q1(4%) Draw a schematic for a 400 nt mRNA and mark 8 important features as precisely as possible. Make sure that you write nucleotide sequence when describing features (as needed) 0.5% for correct answer, 1% off for a wrong answer: 1% EC, but 4% off for incorrect answer: Draw an arrow and label it (above) where splice donor site would meet splice acceptor site ______________________________________________________________________ Q2(4%) Draw a hydropathy plot for a two transmembrane protein: Label three important regions Using the single letter code, write out a possible single transmembrane domain amino acid sequence: __________________________________.