Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Slides:

Advertisements

Similar presentations

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Advertisements

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Fig. 1 CSF1 is increased in blood of melanoma patients and correlates with disease progression. CSF1 is increased in blood of melanoma patients and correlates.

Fig. 7. Intrapatient variation in key contact signatures for PGDM1400 and PGT121. Intrapatient variation in key contact signatures for PGDM1400 and PGT121.

Prediction of IgE-binding epitopes by means of allergen surface comparison and correlation to cross-reactivity Fabio Dall'Antonia, PhD, Anna Gieras,

Sequence and comparison of the SDS protein.

The 3.8 Å resolution cryo-EM structure of Zika virus

Fig. 5. Correlation between CD34+CD45RA−CD90+ cell dose, engraftment success, and onset of neutrophil/platelet recovery in nonhuman primates. Correlation.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

Rapid antigen tests for dengue virus serotypes and Zika virus in patient serum by Irene Bosch, Helena de Puig, Megan Hiley, Marc Carré-Camps, Federico.

Fig. 5. Circulating PPi concentration does not correlate with severity of calcification phenotype in mice. Circulating PPi concentration does not correlate.

Fig. 4. Intramuscular injection of AAV9-Cas9/sgRNA-51 corrects dystrophin expression. Intramuscular injection of AAV9-Cas9/sgRNA-51 corrects dystrophin.

Fig. 3. Structure of ALS-associated RNA binding proteins.

Fig. 8. Gene and protein changes in ALK-dependent STING pathways in human sepsis. Gene and protein changes in ALK-dependent STING pathways in human sepsis.

Fig. 3. Antimicrobial activity is detected in diverse strains of CoNS and not predictable at the species level. Antimicrobial activity is detected in diverse.

Fig. 5. Correlation of tail and long bone growth velocities with Cxm serum concentrations in mice. Correlation of tail and long bone growth velocities.

Strategy for CRISPR/Cas9-mediated genome editing in ΔEx50 mice

Fig. 4. Liver HBV mRNA paired-end sequencing reads in HBeAg-positive and HBeAg-negative chimpanzees. Liver HBV mRNA paired-end sequencing reads in HBeAg-positive.

Fig. 2. Associations between bacterial taxa abundance ascertained by fecal shotgun metagenomic sequencing and the fecal metabolome in healthy pediatric.

Fig. 1 Crohn’s disease association within the LRRK2 locus.

Fig. 3. Frequencies of amino acids at critical PGT121 and contact sites in the SHIV-SF162P3 challenge stock. Frequencies of amino acids at critical.

Fig. 3. A circadian rhythm in fibroblast wound-healing response.

Fig. 2. GPC3 expression in normal and tumor tissues.

Bio-AMS enhances the activity of rifampicin and ethambutol in vitro

Increased ADMA in pregnancy is associated with SGA birth outcomes

Fig. 2. Rapid immunochromatography for specific detection of DENV NS1 proteins (serotypes 1 to 4) and ZIKV NS1 protein. Rapid immunochromatography for.

Fig. 5 Analysis of metabolite changes in M

Dot plots of trisomic versus fetal fractions for cohorts 1 and 2

Fig. 3. Applying the rapid test to analyze human patient sera.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Fig. 6. Epitope mapping of C12G6.

Fig. 2. Rheological characterization and hydrogel differentiation.

Fig. 2. Best model fits. Best model fits. Illustration of the best model fits for the (A) basic, (B) continuous, and (C) cluster models. See Table 1 and.

STAT Genes Found in C. elegans

Figure 3. MAb 19H9 displays broad cross-reactivity with IAV strains of different subtypes. (A), Amino acid sequence ... Figure 3. MAb 19H9 displays broad.

Conformational ensembles of apo and ligated FimH variants in solution

Fig. 1. Map showing the study catchment area in the East of England.

Longitudinal analysis of ZIKV E–specific memory B cell responses in the DENV-experienced donors. Longitudinal analysis of ZIKV E–specific memory B cell.

Fig. 1. In vitro binding and neutralization activities of C12G6.

Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.

Protein sequence alignment of the NS3 helicase–encoding region of 63 flaviviruses demonstrates conservation of a KIR2DS2-binding peptide. Protein sequence.

Fig. 4. The effect of single-dose rozanolixizumab on the concentration of IgG subtypes in healthy subjects. The effect of single-dose rozanolixizumab on.

by Karin Stettler, Martina Beltramello, Diego A

Fig. 5. Mapping of HBV S transcripts from HBeAg-positive and HBeAg-negative chimpanzees. Mapping of HBV S transcripts from HBeAg-positive and HBeAg-negative.

Fig. 3 CSF1 is expressed in human melanoma.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Fig. 7 Vaccine-induced influenza-specific B cells are not maintained in peripheral blood. Vaccine-induced influenza-specific B cells are not maintained.

Fig. 1 Anti-LtxA antibody concentrations in various patient groups.

Identification of the GCS1 ortholog in Gonium pectorale.

IIV induces CD21hiCD27+ and CD21loCD27+ influenza-specific B cells

Fig. 4. Clearance of 12-mer-1 from a nonhuman primate model.

Fig. 4 cTFH1 cells correlate with a boosting of influenza-specific memory B cells. cTFH1 cells correlate with a boosting of influenza-specific memory B.

AKAP15 coimmunoprecipitates with CaV1

Protein sequence alignment of the NS3 helicase–encoding region of 63 flaviviruses demonstrates conservation of a KIR2DS2-binding peptide. Protein sequence.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Structural insights based on chimeric Alp4-GCP2 analysis.

Phylogenetic analysis and domain structure of CALM proteins.

Binding characteristics of mAbs isolated from plasmablasts during acute ZIKV infection. Binding characteristics of mAbs isolated from plasmablasts during.

Evolution-informed forecasting of seasonal influenza A (H3N2)‏

The Alp family of proteins.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

Residues 327 and 404 are key binding sites for GII. 4F MAb

Neutralizing activity of mAbs isolated from plasmablasts during acute ZIKV infection in DENV-experienced donors. Neutralizing activity of mAbs isolated.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test, and ZIKV NS1 test. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test, and ZIKV NS1 test. (A) Table listing mAb names, mAb immunochromatography applications, mAb linear epitope sequences and starting amino acid positions, and NS1 domain positions. (B) Comparison of amino acid similarity based on analysis of NS1 protein sequences from the following viruses: DENV1 (strain Singapore/S275/1990), accession number P33478; DENV2 (strain New Guinea C), accession number AAA42941; DENV3 (strain Philippines/H87/1956), accession number AAA99437; DENV4 (strain Singapore/8976/1995), accession number AAV31422; ZIKV, accession number KU497555.1. Amino acid sequences were compared using Color Align Conservation www.bioinformatics.org/sms2/color_align_cons.html to enhance the output of sequence alignment program. Residues that are identical among the sequences are boxed. Linear peptide epitopes (B) are italicized and indicated in color in the figure, with the key to the right of the figure. Irene Bosch et al., Sci Transl Med 2017;9:eaan1589 Published by AAAS