Dengue virus WHO: 50 - 100 million cases/yr.

Slides:

Advertisements

Similar presentations

Development of a Panel for Dengue Virus Maria Rios, PhD CBER/FDA Blood Products Advisory Committee Meeting December 14, 2010.

Advertisements

Nasty viruses and Institutional Review Boards. WHO: 50 million cases/yr.

Lycorine, its use to inhibit flavivirus activity through the suppression of viral RNA synthesis. An Anti-Flavivirus Therapeutic Available for license Presented.

Yun Zhang J. Craig Venter Institute San Diego, CA, USA August 4, 2012 Integrated Bioinformatics Data and Analysis Tools for Herpesviridae.

VIROLOGY Claude MUVUNYI M.D, Ph.D. Head of Microbiology Unit/NRL RBC.

Three ‐ dimensional solution structure of the 44 kDa ectodomain of SIV gp41 by Michael Caffrey, Mengli Cai, Joshua Kaufman, Stephen J. Stahl, Paul T. Wingfield,

Higher Affinity Heptapeptides Against Influenza Hemagglutinin-Sialic Acid Identification for Treating Flu Virus Disease Ahmed ”e” Al Qaffas.

Royal Thai Army Roles of mosquito vectors, bats, and swine in the epidemiology of emerging and re-emerging infectious diseases Akina Sukasem, 2LT Kanokporn.

Comparative genotypic and phenotypic characterization of

Table 3. Comparison of NS1 Antigen Assay and Platelet Counts

Autophagy reduces Semliki Forest virus replication in neuronal cells

THE story of Specific immunity

تهیه کننده: محمدرفعتی فرد

Growing Viruses Viruses must be grown in living cells

Volume 12, Issue 4, Pages (July 2015)

What Came First—the Virus or the Egg?

limit of light microscope

SMAD About Hepatitis C Virus Cell Entry and Liver Disease

Variance priming for spatially nonoverlapping prime–target pairs.

Viral Structure.

Phosphatase activity associated with Themis and Shp1 in response to different affinity peptide ligands. Phosphatase activity associated with Themis and.

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Pre AP Biology Viruses 8.2.

Pre AP Biology Viruses 8.2.

Functional Analysis of Glycosylation of Zika Virus Envelope Protein

Volume 21, Issue 11, Pages (December 2017)

Molecular Therapy - Nucleic Acids

Figure 2 from Sancho et al.

The cancer stem cell concept in cancer progression and metastasis

Cellular DDX21 RNA Helicase Inhibits Influenza A Virus Replication but Is Counteracted by the Viral NS1 Protein Guifang Chen, Chien-Hung Liu, Ligang.

Structural Surprises from the Flaviviruses and Alphaviruses

Fig. 1 DMF promotes viral infection.

DAI/ZBP1/DLM-1 Complexes with RIP3 to Mediate Virus-Induced Programmed Necrosis that Is Targeted by Murine Cytomegalovirus vIRA Jason W. Upton, William J.

Blastic, angiocentric, Epstein-Barr virus positive B-cell infiltration from colon: haematoxylin and eosin stain (A), CD 20 immunostaining (B) and in situ.

Pre AP Biology Viruses 8.2.

Figure 1 from T Schenk et al.

Figure 4 The heterotrimeric G-protein Gz is involved in the inhibitory effects of PGE1 on endocytosis. The heterotrimeric G-protein Gz is involved in the.

Molecular Therapy - Nucleic Acids

Antiviral activity of human β-defensin 3 against vaccinia virus

Patterns of HIV-1 evolution in individuals with differing rates of CD4 T cell decline Markham RB, Wang WC, Weisstein AE, Wang Z, Munoz A, Templeton A,

Figure. Groups 1–3, patients tested, and test results (viral PCR and antibodies)‏ Groups 1–3, patients tested, and test results (viral PCR and antibodies)

Zika Virus Targets Human STAT2 to Inhibit Type I Interferon Signaling

N-terminal extension of a gene using peptides mapping upstream to an annotated start site. N-terminal extension of a gene using peptides mapping upstream.

Testing the effectiveness of the three-step peptide fractionation method.A, μLC mass chromatograms of SCX fractions for an acidic FFE fraction. Testing.

Biochemical characterization of the protein phosphatases Saci-PP2A.

Volume 11, Issue 9, Pages (September 2004)

Dengue Antibodies, then Zika: A Fatal Sequence in Mice

What is it? By Sandy Decker

Volume 25, Issue 5, Pages (October 2018)

Volume 4, Issue 3, Pages (September 2008)

Activation of PKR by the PBM decoy peptide.

Volume 26, Issue 1, Pages e4 (January 2018)

Phylogenetic tree of medically important flaviviruses based on E protein amino acid diversity. Phylogenetic tree of medically important flaviviruses based.

Expression of IRS2 ameliorates the effects of ATF3 in cultured β-cells

Selectivity-determining regions

Volume 11, Issue 9, Pages (September 2004)

Construction and characterization of YF/NIEV chimera.

Flavivirus serocomplex cross-reactive immunity is protective by activating heterologous memory CD4 T cells by Wilfried A. A. Saron, Abhay P. S. Rathore,

Domain analysis of GmPHD6 binding to LHP1, DNA element, and histone H3

A, one-step viral growth curves: RT treatment increased the virus yield in MV-CEA–treated U87 cells by up to 2 log as compared with MV-CEA infection only.

Representation of the early events involved in JCV infection.

HLA-A*0201 restriction of SSX2-derived p stimulated CD8+ T-cells.

Fig. 1 Prophylactic, neutralization, and therapeutic efficacy of HPAC.

A, expression of p53 downstream mediator p21.

Binding characteristics of mAbs isolated from plasmablasts during acute ZIKV infection. Binding characteristics of mAbs isolated from plasmablasts during.

Peptide RADA16-I. Peptide RADA16-I. (a) Amino acid sequence and molecular model of RADA16-I. The dimensions are ≈5 nm long, 1.3 nm wide, and 0.8 nm thick.

Optimization of incubation time for visibly stained spot formation in Vero-E6 infected by four serotype DENVs and the efficiency of DENV-4 plaque formation.

West African Ebola Virus Strains: Unstable and Ready to Invade?

Neutralizing activity of mAbs isolated from plasmablasts during acute ZIKV infection in DENV-experienced donors. Neutralizing activity of mAbs isolated.

Primary GBM cells support productive HCMV replication in vitro.

Presentation transcript:

dengue virus WHO: 50 - 100 million cases/yr

Acknowledgements Sharon Isern, PhD Yancey Hrobowski, PhD Joshua Costin, PhD Kelli Barr, PhD Krystal Fontaine Craig Rees Cindo Nicholson Robert Garry, PhD - Tulane University Ram Samudrala, PhD - University of Washington Tom Monath, PhD - Acambis Michael Holbrook, PhD - UTX, Galveston Elizabeth Hunsperger, PhD - CDC, San Juan ONR /DTRA /US Army / NIH

Kaufmann, et al. PNAS 103:12400-12404 (2006)

Zhang, et al. Nature Structural Biology 10:907 (2003)

Development of novel virus entry inhibitors host cell inhibitor entry blocked

HOW DO YOU DEVELOP A VIRAL INHIBITOR?

Dengue Plaque Assay control control peptide 57IIb peptide 80FP peptide 81IIb peptide 59PA

DON’T GET FOOLED!

No Toxicity in MTT Assay

Effect of Scrambled Amino Acid Order

Effect of dengue inhibitory peptides on Sindbis virus infectivity

DENV-2 MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY DENV-1 -------------I------V--LI--I--TA- DENV-3 -------------V---LN-L--MV--I--SA- DENV-4 -----E-------V---L--L---V-----SV- WNV L-A----------V----------V-----GAF YFV L-VM--V----S-A--F------GI-T---SAF SLEV L-V----------I------I---------GAF JEV L-A----------I----N-I---V-----GAF RSSEV LTVI-EH------T--FL--------T-L-GAF CEEV LTVI-EH------A--FLS-I-----T-L-GAF

HOW DO THESE THINGS WORK?

Next Steps?