Aligning Sequences You have learned about: Data & databases Tools

Slides:



Advertisements
Similar presentations
Blast to Psi-Blast Blast makes use of Scoring Matrix derived from large number of proteins. What if you want to find homologs based upon a specific gene.
Advertisements

Intro to Bioinformatics Summary. What did we learn Pairwise alignment – Local and Global Alignments When? How ? Tools : for local blast2seq, for global.
Sequence analysis June 20, 2006 Learning objectives-Understand sliding window programs. Understand difference between identity, similarity and homology.
1 Levels of Protein Structure Primary to Quaternary Structure.
©CMBI 2008 Aligning Sequences The most powerful weapon in the bioinformaticist’s armory is sequence alignment. Why? Lets’ think about an alignment. It.
Scoring Matrices June 19, 2008 Learning objectives- Understand how scoring matrices are constructed. Workshop-Use different BLOSUM matrices in the Dotter.
Scoring Matrices June 22, 2006 Learning objectives- Understand how scoring matrices are constructed. Workshop-Use different BLOSUM matrices in the Dotter.
Identifying functional residues of proteins from sequence info Using MSA (multiple sequence alignment) - search for remote homologs using HMMs or profiles.
Introduction to bioinformatics
©CMBI 2005 Why align sequences? Lots of sequences with unknown structure and function. A few sequences with known structure and function If they align,
Single Motif Charles Yan Spring Single Motif.
Structural alignment Protein structure Every protein is defined by a unique sequence (primary structure) that folds into a unique.
PROTEIN SEQUENCE ANALYSIS. Need good protein sequence analysis tools because: As number of sequences increases, so gap between seq data and experimental.
Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
. Sequence Alignment. Sequences Much of bioinformatics involves sequences u DNA sequences u RNA sequences u Protein sequences We can think of these sequences.
Secondary structure prediction
©CMBI 2009 Alignment & Secondary Structure You have learned about: Data & databases Tools Amino Acids Protein Structure Today we will discuss: Aligning.
Manually Adjusting Multiple Alignments Chris Wilton.
1 Protein synthesis How a nucleotide sequence is translated into amino acids.
Amino Acids ©CMBI 2001 “ When you understand the amino acids, you understand everything ”
PROTEIN PATTERN DATABASES. PROTEIN SEQUENCES SUPERFAMILY FAMILY DOMAIN MOTIF SITE RESIDUE.
Alignment & Secondary Structure You have learned about: Data & databases Tools Amino Acids Protein Structure Today we will discuss: Aligning sequences.
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
Pairwise sequence alignment Lecture 02. Overview  Sequence comparison lies at the heart of bioinformatics analysis.  It is the first step towards structural.
Sequence Alignment.
Hyperthermophile subtilases
©CMBI 2008 Databases Data must be in a certain format for software to recognize Every database can have its own format but some data elements are essential.
Step 3: Tools Database Searching
Alignment methods April 17, 2007 Quiz 1—Question on databases Learning objectives- Understand difference between identity, similarity and homology. Understand.
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
Bioinformatics A Summary seminar (with many hints for exam questions)
©CMBI 2009 Transfer of information The main topic of this course is transfer of information. In the protein world that leads to the questions: 1)From which.
Macromolecular and Physical Data Michael J. Watts 1.
Arginine, who are you? Why so important?. Release 2015_01 of 07-Jan-15 of UniProtKB/Swiss-Prot contains sequence entries, comprising
Sequence similarity, BLAST alignments & multiple sequence alignments
Protein Structure Visualisation
LO: SWBAT explain how protein shape is determined and differentiate between the different types of mutations. DN: h/0 protein synthesis HW: Read pp.
Whole process Step by step- from chromosomes to proteins.
Protein Structure and Properties
Have (y)Our Protein Explained
Warm-Up 3/12/13 After transcription, an mRNA molecule with the sequence A U A C G C A G U was created. What was the sequence of the original DNA strand?
Protein Sequence Alignments
Cathode (attracts (+) amino acids)
Protein Structure FDSC400. Protein Functions Biological?Food?
Figure 3.14A–D Protein structure (layer 1)
Protein Engineering Protein engineering Industrial enzymes (Table 8.1)
Haixu Tang School of Inforamtics
Volume 125, Issue 3, Pages (September 2003)
Amino Amigos! Name: _______________________
Entry Task Apply: Suppose a template strand of DNA had the following sequence: DNA: T A C G G A T A A C T A C C G G G T A T T C A A What would.
Amino Acids Amine group -NH2 Carboxylic group -COOH
It og Sundhed Thomas Nordahl Petersen, Associate Professor
Proteins Genetic information in DNA codes specifically for the production of proteins Cells have thousands of different proteins, each with a specific.
Cytochrome.
The 20 amino acids.
Levels of Protein Structure
How to Test an Assertion
Translation.
The 20 amino acids.
It og Sundhed Thomas Nordahl Petersen, Associate Professor
Chapter 18 Naturally Occurring Nitrogen-Containing Compounds
Example of regression by RBF-ANN
Hideki Kusunoki, Ruby I MacDonald, Alfonso Mondragón  Structure 
Thomas Nordahl Petersen, Associate Prof, Food DTU
“When you understand the amino acids,
Three protein kinase structures define a common motif
Thomas Nordahl Petersen, Associate Bioinformatics, DTU
Looking at periodicity in protein sequence and structure
Presentation transcript:

Aligning Sequences You have learned about: Data & databases Tools Amino Acids Protein Structure Today we will discuss: Aligning sequences After this, you are ready to carry out a bioinformatics research project! ©CMBI 2009

TRANSFER OF INFORMATION! Why align sequences? The problem: There a lots of sequences with unknown structure and/or function There are a few sequences with known structure and/or function Alignment can help: If sequences align well, they are likely to be similar If they are similar, then they very likely share structural and/or functional aspects If one of them has known structure/function, then alignment gives us insight in structural and/or functional aspects of the aligned sequence(s) TRANSFER OF INFORMATION! ©CMBI 2009

Sequence Alignment (1) A sequence alignment is a representation of a whole series of evolutionary events, which left traces in the sequences. Things that are more likely to happen during evolution should be most prominently observed in your alignment. The purpose of a sequence alignment is to line up all residues in the sequence that were derived from the same residue position in the ancestral gene or protein. ©CMBI 2009

gap = insertion or deletion Sequence Alignment (2) A B gap = insertion or deletion A B ©CMBI 2009

Structural alignment To carry over information from a well studied protein sequence and its structure to a newly discovered protein sequence, we need a sequence alignment that represents the protein structures today, a structural alignment. The implicit meaning of placing amino acid residues below each other in the same column of a protein (multiple) sequence alignment is that they are at the equivalent position in the 3D structures of the corresponding proteins!! ©CMBI 2009

Examples 1) the 3 active site residues H, D, S, of the serine protease we saw earlier 2) Cysteine bridges (disulfide bridges): STCTKGALKLPVCRK TSCTEG--RLPGCKR ©CMBI 2009

Transfer of information Such information can be: Phosphorylation sites Glycosylation sites Stabilizing mutations Membrane anchors Ion binding sites Ligand binding residues Cellular localization Typically what one finds in the feature (FT) records of Swissprot! ©CMBI 2009

Significance of alignment One can only transfer information if the similarity is significantly high between the two sequences. Schneider (group of Sander) determined the “threshold curve” for transferring structural information from one known protein structure to another protein sequence: If the sequences are > 80 aa long, then >25% sequence identity is enough to reliably transfer structural information. If the sequences are smaller in length, a higher percentage of identity is needed. Structure is much more conserved than sequence! ©CMBI 2009

Significance of alignment (2) ©CMBI 2009

Aligning sequences by hand Most information that enters the alignment procedure comes from the physico-chemical properties of the amino acids. Examples: which is the better alignment (left or right)? 1) CPISRTWASIFRCW CPISRTWASIFRCW CPISRT---LFRCW CPISRTL---FRCW 2) CPISRTRASEFRCW CPISRTRASEFRCW CPISRTK---FRCW CPISRT---KFRCW ©CMBI 2009

Aligning sequences by hand (2) Procedure of aligning depends on information available: Use “only” identity of amino acid and its physico-chemical properties. This is more or less what alignment programs do. Also use explicitly the secondary structure preference of the amino acids. Example: aligning 2 helices when sequence identity is low Use 3D information if one or more of the structures in the alignment are known. In most cases you will start with a alignment program (e.g. CLUSTAL) and then use your knowledge of the amino acids to improve the alignment, for instance by correcting the position of gaps. ©CMBI 2009

Helix ©CMBI 2009

Positional preferences in helices (1) -4 -3 -2 -1 1 2 3 4 5 total - - - - H H H H H ASP 98 110 121 260 98 197 167 49 86 1186 Dataset of good helices from PDB files Count all Asp residues in & before helices Identify preferential positions for Asp residues Position 1 in helix ©CMBI 2009

Positional preferences in helices (2) Fill this table for all 20 amino acids Use this information when aligning helices who have low percentage of sequence identity -4 -3 -2 -1 1 2 3 4 5 total - - - - H H H H H ALA 143 148 99 58 189 205 187 241 268 1538 CYS 24 31 29 22 14 17 18 33 17 205 ASP 98 110 121 260 98 197 167 49 86 1186 GLU 91 100 71 71 152 287 269 70 147 1258 (…) TRP 29 25 29 14 30 26 28 30 29 240 TYR 66 65 75 33 58 44 56 72 48 517 Position 1 in helix ©CMBI 2009

Aligning 2 helices when sequence identity is low Helix 1: S G V S P D Q L A A L K L I L E L A L K Helix 2: G T S L E T A L L M Q I A Q K L I A G ©CMBI 2009

Aligning 2 helices when sequence identity is low (2) S G V S P D Q L A A L K L I L E L A L K -1-4-4-1-4-1 3-2 1 1-2 2 -3-2 -3 2 5 1 2 2 1 5 4 -2 3 4 3 3 4 1 5 4 4 5 5 5 G T S L E T A L L M Q I A Q K L I A G -4-1-1-2 2-1 1-2 -3 3 1 3 3 2 1 4 3 4 5 4 5 5 Final alignment: S G V S P D Q L A A L K L I L E L A L K - G T S L E T A L L M Q I A Q K L I A G ©CMBI 2009

Use of 3D structure info (1) 2 If you know that in structure 1 the Ala is pointing outside and the Ser is pointing inside: Where does the Arg in structure 2 go? (and what will CLUSTAL choose?) ©CMBI 2009

Use of 3D structure info (2) 1 2 3 4 5 6 7 8 9 10 11 A ILE CYS ARG LEU PRO GLY SER ALA GLU ALA VAL B1 VAL CYS ARG THR PRO --- --- --- GLU ALA ILE B2 VAL CYS ARG --- --- --- THR PRO GLU ALA ILE ©CMBI 2009

An even more real example 1 2 3 4 5 6 7 8 9 10 11 A ILE CYS ARG LEU PRO GLY SER ALA GLU ALA VAL B1 VAL CYS ARG THR PRO --- --- --- GLU ALA ILE B2 VAL CYS ARG --- --- --- THR PRO GLU ALA ILE G- - PP- S-T LT- A-P RRR EEE CCC IVV AAA V I I ©CMBI 2009

We have seen that alignments …. Are crucial for being able to transfer information Can be optimized by using secondary structure preferences (e.g. helix positioning) Can be optimized by using 3D structure info ©CMBI 2009

Multiple sequence alignments If we have more than two sequences aligned, the alignment is called a multiple sequence alignment (MSA) MSA’s can: confirm or improve pair-wise sequence alignments reveal structural information (e.g. cys-bridges) validate PROSITE search results ©CMBI 2009

MSA for improvement of pair-wise alignments CWPVAASYGR CWPT---YGR CWPTA-SYGR CWPTLGLFGR ©CMBI 2009

MSA and cysteine bridges Multiple sequence alignments can reveal structural information: 1 2 3 4 ASCTRGCIKLPTCKKMGRCTGY STCTKGALKLPVCRKMGKSSAY ATSTHGCMKLPCSRRFGKCSSY TSCTEGCLRLPGCKRFGRCTSY TTCTKGLLKLPGCKRFGKSSAY ASSTKGCMKLPVSRRFGRCTAY ©CMBI 2009

MSA to validate PROSITE results (1) PROSITE glycosylation pattern: N-{P}-[ST]-{P} where N is the glycosylation site. PROSITE Syntax: A-[BC]-X-D(2,5)-{EFG}-H Means: A B or C Anything 2-5 D’s Not E,F or G H ©CMBI 2009

MSA to validate PROSITE results (2) The chance of finding N-{P}-[ST]-{P} is rather high. So how can you be sure? Look at the multiple sequence alignment: ASLRNASTVVTIGDTITGNLTLASYHW GSIKNGSSVITLPGTMEGNLSTTTYHY ATLRNASTVMEINGTITGDLTLASFHW ©CMBI 2009

What you have learned today (and will need for your own project) A good sequence alignment is necessary to carrying over information between proteins. Putting amino acids below each other in a sequence alignment implies that you predict that they are on equivalent positions in both proteins. If the aligned sequences are > 80 aa long, then >25% sequence identity is enough to reliably transfer structural information. You need to use all structural information available to you to optimize the sequence alignment. This can be real 3D data, but can also be “just” your own knowledge about the properties and preferences of the amino acids. ©CMBI 2009