RuBisCo Gene Diversity in Cyanobacteria of Lake Menomin

Slides:



Advertisements
Similar presentations
Table 1. Degenerate potyvirus primers used to detect potyviruses in Iraqi plants by RT-PCR. NT: not tested, NS: non specific bands, +: positive, -: negative,
Advertisements

An analysis of the microbial communities of the Mojave Desert serving as a terrestrial model for the environment of Mars Elaine P. Bryant NASA Spaceward.
Characterization of nitrogenase gene distribution and activity in WCA-2A periphyton Puja Jasrotia Image source:
Determining the roles of the BTB genes At2g04740, At4g08455, At1g04390, and At2g30600 in Arabidopsis thaliana growth and development. Brandon D. Blaisdell,
METAGENOMICS OF CYANOBACTERIAL BLOOMS Phillip B Pope and Bharat K.C. Patel Microbial Gene Research and Resources Facility, School of Biomolecular and Biomedical.
Yaron Fireizen, Vinay Rao, Lacy Loos, Nathan Butler, Dr. Julie Anderson, Dr. Evan Weiher ▪ Biology Department ▪ University of Wisconsin-Eau Claire From.
Jenifer Unruh VCU-HHMI Summer Scholars Program Mentor: Dr. Shozo Ozaki.
Immune profiling with high-throughput sequencing Harlan Robins 1,2 Cindy Desmarais 2, Chris Carlson 1,2 Fred Hutchinson Cancer Research Center, Seattle,
Characterization of microbial communities in a fluidized-pellet-bed bioreactor by DGGE analysis As an extension of the fluidized pellet bed operation used.
Lecture 1. Microorganisms: an overview Chapter 1. Microorganisms and Microbiology Chapter 2. An overview of microbial life. Cell and viral structures DNA.
Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.
QUANTIFICATION OF SOYBEAN-ASSOCIATED SOIL RHIZOBIA WITH QUANTITATIVE POLYMERASE CHAIN REACTION Branden Furseth, Shawn Conley, Jean-Michel Ané Dept. of.
Observation Hypothesis Experimental Design (including Methods) Results Inference Camp Wildness 2004 Ward Lab Research Project.
Plant Molecular Systematics Michael G. Simpson
Institute of Soil Ecology Diversity of cbbL genes from autotrophic bacteria in differently managed agricultural soils Draženka Selesi, Susanne Stein, Isabelle.
Recombinant DNA Technology……….. BTEC3301. DNA Libraries How do you identify the gene of interest and clone only the DNA sequence you are interested? Read.
Microbial Community Biomarker in Barnegat Bay Evangelina Pena 1, Lora McGuinness 1, Gary Taghon 1, Lee Kerkhof 1 Introduction Efforts to remediate anthropogenic.
Introduction Nitrogen is one of the most essential nutrients for plant growth and development. However, plants are unable to use nitrogen in its natural.
Genetic diversity of Manayunkia speciosa in the Klamath River basin
Diversity of uncultured candidate division SR1 in anaerobic habitats James P. Davis Microbial & Molecular Genetics Oklahoma State University.
Transcriptional responses of a hot spring microbial mat to nutrient additions Space Grant Consortium Research Symposium Zureyma Martinez, ASU/NASA Space.
Molecular Detection of Karenia spp. in the Mid-Atlantic Kathryn J. Coyne 1, Edward Whereat 1, Muns Farestad 1, Jennifer Torora 1, Lauren Salvitti 1 and.
Calculating branch lengths from distances. ABC A B C----- a b c.
Chapter 24: Molecular and Genomic Evolution CHAPTER 24 Molecular and Genomic Evolution.
RACE-Amplification and Cloning of Winter Flounder Psuedopleuronectes americanus Cytochrome P450 1A. Abstract: Winter flounder are found all along the US.
Shinnecock Bay Crabs and Biodiversity Abstract: The birth of this project of an exploration in biodiversity began on an excursion to the Shinnecock Bay.
Introduction Biodiversity is important in an ecosystem because it allows the species living in that ecosystem to adapt to changes made in the environment.
Soil Microbiome of Native and Invasive Marsh Grasses in Blackbird Creek, Delaware Lathadevi K.Chintapenta 1#, Gulnihal Ozbay 1#, Venu Kalavacharla 1* Figure.
Introduction to Bioinformatics Resources for DNA Barcoding
Volume 20, Issue 8, Pages (August 2013)
Genomic Data Manipulation Thinking about data visually
Whole Genome Sequencing of Brucella melitensis Isolates for the Identification of Biovar, Variants and Relationship within a Biovar *Shaheed F [1], Habibi.
Pipelines for Computational Analysis (Bioinformatics)
Volume 20, Issue 8, Pages (August 2013)
Figure 1. Exploring and comparing context-dependent mutational profiles in various cancer types. (A) Mutational profiles of pan-cancer somatic mutations,
Workshop on the analysis of microbial sequence data using ARB
Various types of bacteria
B3- Olympic High School Bioinformatics
Genomic Data Manipulation
Randomness Testing in DNA Samples
Randomness Testing in DNA Samples
Tiago R. Matos, Menno A. de Rie, Marcel B.M. Teunissen 
Relative volume of the ocean and Earth.
Volume 20, Issue 8, Pages (August 2013)
Genes to Trees Daniel Ayres and Adam Bazinet
Relationship between Genotype and Phenotype
by Paul N. Evans, Donovan H. Parks, Grayson L. Chadwick, Steven J
Explore Evolution: Instrument for Analysis
L. Dubourg  Clinical Microbiology and Infection 
Chapter 19 Molecular Phylogenetics
Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family  Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito 
Volume 9, Issue 9, Pages (September 2016)
G. Charles Ostermeier, Ph. D. , Robert J. Goodrich, B. S. , Michael P
Phylogenetic tree of perA A2-domain DNA sequence.
(A) Tiled view of an ESOM map constructed using all 51 metagenome bins assembled from the samples collected in this study, with the white square encompassing.
Phylogenetic tree based on 16S rRNA gene sequence comparisons over 1,260 aligned bases showing the relationship between species of the genus Actinomyces.
Human isolates of Aeromonas possess Shiga toxin genes (stx1 and stx2) highly similar to the most virulent gene variants of Escherichia coli  A. Alperi,
Analysis of GFP expression in gfp loss-of-function mutants.
The human GPR109A promoter is methylated and GPR109A expression is silenced in human colon carcinoma cells. The human GPR109A promoter is methylated and.
Isolation and Characterization of Viruses Related to the SARS Coronavirus from Animals in Southern China by Y. Guan, B. J. Zheng, Y. Q. He, X. L. Liu,
Allergens are distributed into few protein families and possess a restricted number of biochemical functions  Christian Radauer, PhD, Merima Bublin, PhD,
Genomic phylogeny reveals the long-term coexistence of diverse clades.
Phylogenetic comparison among selected Pasteurella multocida and Haemophilus influenzae species with completed genome sequences. Phylogenetic comparison.
Neighbor-joining distance tree based on Hsp90 sequences indicating that the cytosolic and ER resident forms of these protein form paralogous gene families,
Volume 70, Issue 5, Pages (May 2019)
Characterization of SsPV1/WF-1 isolated from hypovirulent strain WF-1.
Volume 25, Issue 5, Pages (March 2015)
(A) Bayesian phylogenetic tree of the H gene nucleotide alignment from tigers Pt2004 and Pt and representative CDV sequences obtained from GenBank.
The Effect of Humans in The Environment
Unrooted neighbor-joining tree of 16S rRNA gene sequences from low-G+C-content gram-positive bacteria, obtained from clone libraries. Unrooted neighbor-joining.
Presentation transcript:

RuBisCo Gene Diversity in Cyanobacteria of Lake Menomin Background & Purpose Lake Menomin (Menomonie, WI, Fig. 1) has high phosphorous levels and experiences blooms of cyanobacteria that adversely affect the health of the freshwater ecosystem (Fig. 2). Ribulose bisphosphate carboxylase (RuBisCO) is a key protein in the carbon fixation pathway of cyanobacteria. The diversity of this gene was analyzed in Lake Menomin to determine targets for population control. Lauren Bryans Supervised by Dr. Stephen Nold Methods Collect Water Column Samples Amplify RuBisCO gene using the PCR Isolate Genomic DNA http://www.all-wisconsin-fishing.com/menomin-dunn.gif Determine Closest Relatives in GenBank (Table 1) Compile and analyze sequences in BioEdit (Fig. 3) Clone, and purify DNA, obtain sequence Data Figure 4: Amino Acid neighbor joining phylogenetic tree. Our data indicate that the diversity of cyanobacteria in L. Menomin is low. Figure 1: Lake Menomin Assemble phylogenetic trees (Figs. 4, 5) http://tmlia.blogspot.com/2009/08/fact-finding-meeting-toxic-blue-green.html Results Figure 5: DNA Distance Matrix Tree. The tree indicates that the diversity of cyanobacteria is low in L. Menomin. Conclusion Phylogenies indicated that our sequences were closely related to Rhodopseudomonas palustris and Microcystis aeruginosa (Figs. 4,5). The diversity of cyanobacterial RuBisCO genes is low in Lake Menomin, suggesting fewer targets for efforts designed to control populations of these nuisance organisms. Source Distribution of RuBisCO Genotypes along a Redox Gradient in Mono Lake, California Bruno J. Giri, Nasreen Bano, and James T. Hollibaugh Appl Environ Microbiol. 2004 June; 70(6): 3443–3448.  Figure 2: Cyanobacterial bloom issue in Lake Menomin Figure 3: Raw RuBisCO sequence data compiled in BioEdit Table 1: Table of the closest relatives of our sequences based on GenBank data.