Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Slides:

Advertisements

Similar presentations

Supplemental Fig. S1 Ihsan et al., 2015 Supplemental Fig. S1 Sequence analysis of Solanaceous MAGO NASHI genes. ClustalW multiple alignments of nucleotide.

Advertisements

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Etheridge_Fig. S1 NTD * * (368) (154) (296) (131) (146) (477) (271) (391) (141) (248) CTDCTD (570) (363) (483) (232) (340) (675) (446) (588) (318) (422)

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

(a) (b) Figure S1. Amino acid sequence alignment of human and pig FSD2. The amino acid sequence of porcine FSD2 (determined in this study), is aligned.

Supplemental Figure S2. Sequence comparison of the Arabidopsis homologue of PAHX with human PHYD1 (phytanoyl-CoA dioxygenase domain containing 1) and human.

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

by Parisa Asvadi, Zohra Ahmadi, and Beng H. Chong

Sebastian Meyer, Raimund Dutzler Structure

Structure of an LDLR-RAP Complex Reveals a General Mode for Ligand Recognition by Lipoprotein Receptors Carl Fisher, Natalia Beglova, Stephen C. Blacklow

ClustalOmega alignment of FlaC protein sequences.

Phosphopeptides identified harboring minimal binding motifs

Volume 124, Issue 2, Pages (January 2006)

Debanu Das, Millie M Georgiadis Structure

Molecular Basis of Box C/D RNA-Protein Interactions

Volume 108, Issue 6, Pages (March 2002)

Volume 10, Issue 12, Pages (December 2002)

The MSP domain of MOSPD2 binds the FFAT motif

H3 HA amino acid mutations that were selected in indicated clades.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

(A) Six missense mutations in six essential genes that are not in annotated functional domains. (A) Six missense mutations in six essential genes that.

Volume 12, Issue 1, Pages (March 2004)

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Volume 10, Issue 1, Pages (January 2003)

STAT Genes Found in C. elegans

Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap Nathan I. Nicely, Justin Kosak, Vesna de Serrano,

Error-Prone DNA Polymerases

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Daniel Peisach, Patricia Gee, Claudia Kent, Zhaohui Xu Structure

Structure and Mechanism of Yeast RNA Triphosphatase

Volume 21, Issue 6, Pages (June 2013)

Structure, Exchange Determinants, and Family-Wide Rab Specificity of the Tandem Helical Bundle and Vps9 Domains of Rabex-5 Anna Delprato, Eric Merithew,

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Antonina Roll-Mecak, Chune Cao, Thomas E. Dever, Stephen K. Burley

Volume 8, Issue 11, Pages (November 2000)

Tertiary Structure of Destrin and Structural Similarity between Two Actin-Regulating Protein Families H Hatanaka, K Ogura, K Moriyama, S Ichikawa, I.

Bioinformatics analysis of the small TbTim amino acid sequences.

Mutations in Cohesin Complex Members SMC3 and SMC1A Cause a Mild Variant of Cornelia de Lange Syndrome with Predominant Mental Retardation Matthew A.

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

Gregory J. Miller, James H. Hurley Molecular Cell

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Sequence conservation across the Ub-binding sites of human USPs

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

Helicase structures: a new twist on DNA unwinding

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Fig. 2. RGD and KGD motifs in N. vectensis thrombospondins

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Three protein kinase structures define a common motif

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

S. moellendorffii BBI3 Is Predicted to Be a BBI Based on Sequence Similarity at the Inhibitory Motifs and Shared Primary Protein Architecture. S. moellendorffii.

Sequence alignment of colicin lysis proteins.

Volume 8, Issue 11, Pages (November 2000)

Volume 95, Issue 2, Pages (October 1998)

Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with ClustalW (http://www.ch.embnet.org/software/ClustalW.html). Identical and similar residues are shaded black and gray, respectively; aspartate-rich motif DDxxD are indicated in red-colored box, the latter one involved in binding of the magnesium ion and corresponds to the class I type of cyclization. The function of the other one located more upstream is unknown, but could possibly be involved in a protonation type cyclization, which has been proposed by Kwon et al. (2014).