Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Slides:

Advertisements

Similar presentations

Sequencing a genome and Basic Sequence Alignment Lecture 8 1Global Sequence.

Advertisements

Sequencing a genome and Basic Sequence Alignment

Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.

Bioinformatics Analysis of YqjG: an introduction and some questions YqjG: “Uncharacterized protein” from Escherichia coli UniProt ID = P42620 (YQJG_ECOLI)

Discover the UniProt Blast tool. Murcia, February, 2011Protein Sequence Databases Customize the BLAST results.

Figure S1_Yao Qin et al. Figure S1 Occurrence and distribution of trihelix family in different plant species. Red branches in the cladogram indicate that.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Sequencing a genome and Basic Sequence Alignment

Construction of Substitution Matrices

AMPK and Apoptosis Emeline Van Goethem José Manuel López Apoptosis or programmed cell death is an important part of the development of all multicellular.

HMMs for alignments & Sequence pattern discovery I519 Introduction to Bioinformatics.

Condor: BLAST Rob Quick Open Science Grid Indiana University.

Identifying property based sequence motifs in protein families and superfamies: application to DNase-1 related endonucleases Venkatarajan S. Mathura et.

Finding conserved transcription factor binding sites in promoter sequences NfkappaB motifs in promoters controling human NFkappaB gene family members Markella.

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Construction of Substitution matrices

Supplementary Figure S1. Schematic structure of hardwood xylan. GlcA, glucuronic acid; Me, methyl; Ac, acetyl; Xyl, xylose. Arabidopsis genes most closely.

Using BLAST and ClustalW2 for Multiple Sequence Alignment IBGP/BMI705 Lab 2 January 14, 2009 Lee Cooper, TA

Protein motif /domain Structural unit Functional unit Signature of protein family How are they defined?

Graphical representation of an amino acid or nucleic acid multiple sequence alignment developed by Tom Schneider and Mike.

Supplementary Fig 1. Multiple sequence alignment of nucleotide sequences from amplified region of different Oryza sativa lines and wild species of rice.

Protein Structure and Function. Proteins are organic compounds made from amino acids held together by peptide bonds.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins

Supplementary file 1. Construct design of tagged Wnt proteins.

a. ZEP ZEP Os04g Selmo Phypa Chlre CTF2B

Figure S1. Sequence alignment of Arabidopsis NodGS with other plant and fungal orthologues. Abbreviations are as follows: Populus trichocarpa (Ptr), Ricinus.

Supplemental Figure S2. Sequence comparison of the Arabidopsis homologue of PAHX with human PHYD1 (phytanoyl-CoA dioxygenase domain containing 1) and human.

Homozygosity Mapping Reveals Mutations of GRXCR1 as a Cause of Autosomal- Recessive Nonsyndromic Hearing Impairment Margit Schraders, Kwanghyuk Lee, Jaap.

Bioinformatics and BLAST

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Evolution of Biochemical Pathways

Sequence and comparison of the SDS protein.

Multiple sequence alignment and analysis of SOFL proteins.

Secreted Fringe-like Signaling Molecules May Be Glycosyltransferases

Prediction of protein structure

TGFβ Signaling: Receptors, Transducers, and Mad Proteins

The future of protein secondary structure prediction accuracy

Phosphopeptides identified harboring minimal binding motifs

RSPO4 Is the Major Gene in Autosomal-Recessive Anonychia and Mutations Cluster in the Furin-Like Cysteine-Rich Domains of the Wnt Signaling Ligand R-spondin.

(A) Six missense mutations in six essential genes that are not in annotated functional domains. (A) Six missense mutations in six essential genes that.

Volume 64, Issue 5, Pages (November 2003)

Identification of novel F-box proteins in Xenopus laevis

Author correction: Triple association of CDC25-, Dbl- and Sec7-related domains in mammalian guanine nucleotide exchange factors C. Abergel, P. Chavrier,

Supplementary Fig. 1. Sequence alignment between s from diverse species Supp Fig 1: Sequence alignment of uncharacterized family protein,

Volume 139, Issue 3, Pages e3 (September 2010)

Taninee Sahakitrungruang, M. D. , Suttipong Wacharasindhu, M. D

Tracy M. Bryan, Karen J. Goodrich, Thomas R. Cech Molecular Cell

A.P. Underwood, J. Green Clinical Microbiology and Infection

Linking transcriptional mediators via the GACKIX domain super family

A B 100 PgHMGR1 98 EsHMGR 82 EuHMGR SmHMGR Plant PgHMGR2 77

CARPEL FACTORY, a Dicer Homolog, and HEN1, a Novel Protein, Act in microRNA Metabolism in Arabidopsis thaliana Wonkeun Park, Junjie Li, Rentao Song,

Crystal Structure of Saccharopine Reductase from Magnaporthe grisea, an Enzyme of the α-Aminoadipate Pathway of Lysine Biosynthesis Eva Johansson, James.

L. Aravind, Eugene V. Koonin Current Biology

Bioinformatics analysis of the small TbTim amino acid sequences.

AKAP15 coimmunoprecipitates with CaV1

Structure prediction: Folding proteins by pattern recognition

How to search NCBI.

Missense Mutations in the N-Terminal Domain of Human Phenylalanine Hydroxylase Interfere with Binding of Regulatory Phenylalanine Torben Gjetting, Marie.

Alignment of Wt1 genomic regions reveals a highly conserved element upstream of zebrafish wt1a. Alignment of Wt1 genomic regions reveals a highly conserved.

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Structural features of Rps26a.

Volume 61, Pages (August 2016) Phenotypes and Genotypes in Five Children with Congenital Insensitivity to Pain with Anhidrosis Qing-Li Wang, MD,

L. Aravind, Eugene V. Koonin Current Biology

A, structure of the deduced polypeptides coded by MAGE-E1 mRNAs.

Correspondence Current Biology

Presentation transcript:

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1 Supplementary Figure S2. Amino acid sequence alignment of the five members of the Arabidopsis PAR1-family proteins (LAT1-5) shows a number of conserved regions and motifs throughout the protein sequence. Motifs were identified using Multiple Em for Motif Elicitation online tool (http://meme-suite.org/tools/meme) with the default settings except that the number of motif to be identified was changed from 3 to 6. Motifs in Arabidopsis LATs were searched along with related LAT and/or Y+LAT members from Oryza sativa, Homo sapiens, and Mus Musculus. Sequence alignment was carried out using Vector NTI 10 AlingX tool.