Multiple sequence alignment and analysis of SOFL proteins.

Slides:

Advertisements

Similar presentations

Multiple sequence alignment and alignment editor.

Advertisements

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Membrane topology prediction of the SLC45A2 protein using TMHMM (v. 2

Conservation of Structure and Mechanism between Eukaryotic Topoisomerase I and Site-Specific Recombinases Chonghui Cheng, Paul Kussie, Nikola Pavletich,

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Sequence alignment of C-terminal phosphorylated plant aquaporins

Grouping of Multiple-Lentigines/LEOPARD and Noonan Syndromes on the PTPN11 Gene Maria Cristina Digilio, Emanuela Conti, Anna Sarkozy, Rita Mingarelli,

Sequence and comparison of the SDS protein.

Multiple sequence alignment of S

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Extension of the GlyRβ binding site on gephyrin.

Acid detergent lignin (ADL) concentrations were determined by NIRS prediction based on the calibration equation (Table S1). Acid detergent lignin (ADL)

Epitopes in the Linker Subdomain Region of Envoplakin Recognized by Autoantibodies in Paraneoplastic Pemphigus Patients Bingxin Zhang, Rui Zheng, Jing.

Phosphopeptides identified harboring minimal binding motifs

Deubiquitination of H2B by the SAGA complex destabilizes H2B.

Figure 1. Generation of the S250F Aadc mutant mice

Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Figure 3 Molecular genetics

STAT Genes Found in C. elegans

De Novo Mutations in the Sodium-Channel Gene SCN1A Cause Severe Myoclonic Epilepsy of Infancy Lieve Claes, Jurgen Del-Favero, Berten Ceulemans, Lieven.

Volume 23, Issue 4, Pages (April 2015)

Structure of Bax Motoshi Suzuki, Richard J. Youle, Nico Tjandra Cell

Fine mapping assay with a G6 peptide library identifies two epitopes recognized by the anti-P39 antibody. Fine mapping assay with a G6 peptide library.

Yusuke Nakasone, Kazunori Zikihara, Satoru Tokutomi, Masahide Terazima

Analysis of GFP expression in gfp loss-of-function mutants.

Bioinformatics analysis of the small TbTim amino acid sequences.

Schematic drawing of alternatively-spliced GFP reporter gene.

Ulp1-SUMO Crystal Structure and Genetic Analysis Reveal Conserved Interactions and a Regulatory Element Essential for Cell Growth in Yeast Elena Mossessova,

iraL shares sequence identity with iraM from E

Identification of the GCS1 ortholog in Gonium pectorale.

Correction of Gene Annotation and Other Sequence Analysis of Arabidopsis Proteins Identified on the 2-D Gels in Figure 1.(A) Spot 71, identified as a 17.2-kD.

Gene ontology (GO) term enrichment for significantly downregulated genes. Gene ontology (GO) term enrichment for significantly downregulated genes. Visualization.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

The Gene Mutated in Variant Late-Infantile Neuronal Ceroid Lipofuscinosis (CLN6) and in nclf Mutant Mice Encodes a Novel Predicted Transmembrane Protein

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Figure 1 Pedigree and genetic findings

The family of bone morphogenetic proteins

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Sampling locations and IDs for accessions sequenced in this study.

PfSec13 is a structural homolog of ScSec13·Nup145C.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

(A) yellow cDNA comparison among wild-type and ch mutants

Frequency distribution of total leaf number for an F2 population derived from a cross of Van-0 with Ler, grown in long days. Frequency distribution of.

Alignment of the fast/developmental and IIM MYH genes.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

SUR-8, a Conserved Ras-Binding Protein with Leucine-Rich Repeats, Positively Regulates Ras-Mediated Signaling in C. elegans Derek S Sieburth, Qun Sun,

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

(A) Segregation of mutations in TMEM231 in JBTS families.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Conservation of key sequence features and endocytic localisation in TbCALM. Conservation of key sequence features and endocytic localisation in TbCALM.

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Structural insights based on chimeric Alp4-GCP2 analysis.

Figure 2 Compound heterozygous mutations in ADAM22

Sequence comparisons of fungal HOG1 orthologues.

OMV-enriched proteins show a conserved N-terminal LES motif.

Predicted pathogenic BRCA1 amino acid substitutions are confined to the evolutionarily conserved N- and C-terminal domains. Predicted pathogenic BRCA1.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

Residues 327 and 404 are key binding sites for GII. 4F MAb

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Multiple sequence alignment and analysis of SOFL proteins. Multiple sequence alignment and analysis of SOFL proteins. (a) Illustration showing the topology of SOFL proteins. Purple rectangular blocks represent the two conserved domains, SOFL-A and SOFL-B. (b) Partial N-terminal amino acid sequence alignment of Arabidopsis thaliana SOFL proteins. The alignment was obtained using JalView Probcons with Defaults program (Malek 2001; Zhang 2003). Semi-conserved amino acids are indicated with a light purple shade. Conserved amino acids are indicated by a darker purple shade. Red squares indicate amino acid residues that were selected for site-directed mutagenesis. WebLogo© analysis of conserved, (c) SOFL-A domain, and (d) SOFL-B domain, using all 289 SOFL protein sequences (Lin and Hu 2013). Red asterisk denotes 100% conserved amino acid residues among all 289 SOFL sequences. Reuben Tayengwa et al. G3 2018;8:1281-1290 ©2018 by Genetics Society of America