Structure Prediction: How good are we?

Slides:



Advertisements
Similar presentations
Elena Conti, Nick P Franks, Peter Brick  Structure 
Advertisements

Mark E. Zweifel, Daniel J. Leahy, Doug Barrick  Structure 
Molecular evolution: Actin's long lost relative found
Crystal Structure of the Tandem Phosphatase Domains of RPTP LAR
Volume 8, Issue 3, Pages (September 2001)
Crystal Structure of M. tuberculosis ABC Phosphate Transport Receptor
Kristopher Josephson, Naomi J. Logsdon, Mark R. Walter  Immunity 
The first crystal structure of a phospholipase D
Volume 11, Issue 5, Pages (May 2003)
The crystal structure of bovine bile salt activated lipase: insights into the bile salt activation mechanism  Xiaoqiang Wang, Chi-sun Wang, Jordan Tang,
Volume 8, Issue 6, Pages (December 2001)
Volume 124, Issue 1, Pages (January 2006)
Identification of Phe187 as a Crucial Dimerization Determinant Facilitates Crystallization of a Monomeric Retroviral Integrase Core Domain  Meytal Galilee,
Solution Structure of the U11-48K CHHC Zinc-Finger Domain that Specifically Binds the 5′ Splice Site of U12-Type Introns  Henning Tidow, Antonina Andreeva,
Transcription: Identification of a prime suspect
Debanu Das, Millie M Georgiadis  Structure 
Volume 8, Issue 2, Pages (August 2001)
Volume 34, Issue 4, Pages (May 2009)
Volume 99, Issue 1, Pages (October 1999)
Volume 108, Issue 2, Pages (January 2002)
Structure of the TPR Domain of p67phox in Complex with Rac·GTP
Volume 14, Issue 5, Pages (May 2006)
Volume 90, Issue 4, Pages (August 1997)
Volume 11, Issue 11, Pages (November 2003)
David R Buckler, Yuchen Zhou, Ann M Stock  Structure 
a MELLFLGTGAGIPAKARNVTSVALKLLEERRSVWLFDCGEATQHQILHTT
N Khazanovich, KS Bateman, M Chernaia, M Michalak, MNG James  Structure 
Site-specific recombination in plane view
Structure of Bax  Motoshi Suzuki, Richard J. Youle, Nico Tjandra  Cell 
Stacy D Benson, Jaana K.H Bamford, Dennis H Bamford, Roger M Burnett 
A Molecular Dynamics Study of Ca2+-Calmodulin: Evidence of Interdomain Coupling and Structural Collapse on the Nanosecond Timescale  Craig M. Shepherd,
Volume 28, Issue 6, Pages (December 2007)
Structure prediction: The state of the art
Volume 124, Issue 5, Pages (March 2006)
Daniel Peisach, Patricia Gee, Claudia Kent, Zhaohui Xu  Structure 
Epigenetics: SUPERMAN Dresses Up
Volume 3, Issue 4, Pages (April 1999)
Volume 5, Issue 3, Pages (March 1997)
Martin Klumpp, Wolfgang Baumeister, Lars-Oliver Essen  Cell 
Volume 7, Issue 2, Pages (February 1999)
Volume 4, Issue 10, Pages (October 1996)
Volume 101, Issue 4, Pages (May 2000)
Ideas of Order for Amyloid Fibril Structure
Volume 6, Issue 1, Pages (July 2000)
Structural Basis for FGF Receptor Dimerization and Activation
Structural Basis of Rab Effector Specificity
Silvia Onesti, Andrew D Miller, Peter Brick  Structure 
Volume 26, Issue 14, Pages R661-R662 (July 2016)
Volume 11, Issue 2, Pages (February 2003)
Volume 7, Issue 8, Pages (August 1999)
Volume 85, Issue 5, Pages (May 1996)
Volume 22, Issue 8, Pages (August 2015)
NSF N-Terminal Domain Crystal Structure
Volume 84, Issue 1, Pages (January 2003)
The first crystal structure of a phospholipase D
Stacy D Benson, Jaana K.H Bamford, Dennis H Bamford, Roger M Burnett 
Volume 8, Issue 5, Pages (May 2000)
Volume 13, Issue 5, Pages (May 2005)
Pingwei Li, Gerry McDermott, Roland K. Strong  Immunity 
Structure of CD94 Reveals a Novel C-Type Lectin Fold
Luc Bousset, Hassan Belrhali, Joël Janin, Ronald Melki, Solange Morera 
Kristopher Josephson, Naomi J. Logsdon, Mark R. Walter  Immunity 
Three protein kinase structures define a common motif
Corin: a serine protease
Volume 6, Issue 8, Pages (August 1998)
The Structure of Sortase B, a Cysteine Transpeptidase that Tethers Surface Protein to the Staphylococcus aureus Cell Wall  Yinong Zong, Sarkis K Mazmanian,
The Crystal Structure of an Unusual Processivity Factor, Herpes Simplex Virus UL42, Bound to the C Terminus of Its Cognate Polymerase  Harmon J Zuccola,
Morgan Huse, Ye-Guang Chen, Joan Massagué, John Kuriyan  Cell 
Debanu Das, Millie M Georgiadis  Structure 
Volume 95, Issue 2, Pages (October 1998)
Presentation transcript:

Structure Prediction: How good are we? R.B. Russell, M.J.E. Sternberg  Current Biology  Volume 5, Issue 5, Pages 488-490 (May 1995) DOI: 10.1016/S0960-9822(95)00099-6

Figure 1 A comparison of the known and predicted secondary structures of PH domains (the pleckstrin sequence is of its amino-terminal PH domain). From the top, the figure shows: the aligned sequences of three PH domains (white background); the experimentally determined secondary structures (grey background); and the predicted secondary structures (yellow background). Blue arrows indicate β strands, red tubes α helices. The experimentally determined secondary structures were taken from the literature, except in the case of the R.Dynamin X-ray structure, for which Kabsch and Sander's DSSP program [22] was used. The figure was made using the ALSCRIPT program [23]. Current Biology 1995 5, 488-490DOI: (10.1016/S0960-9822(95)00099-6)

Figure 2 Crystal structure of the dynamin PH domain [11]. β strands are shown as arrows and the α helix as a cylinder. Structures predicted by Musacchio et al.[2] are shown mapped on to the structure: red, β strand; purple, α helix. Current Biology 1995 5, 488-490DOI: (10.1016/S0960-9822(95)00099-6)