GLUTAMINASE - Phylogenetic tree construction

Slides:

Advertisements

Similar presentations

Undergraduate Exercises with Trp Cage Paula Evans, Chet Fornari, Jeff Hansen, Jennifer Inlow, Larry Merkle.

Advertisements

Structural bioinformatics

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc. 04.

Profile-profile alignment using hidden Markov models Wing Wong.

Introduction to bioinformatics

Molecular Evolution, Part 2 Everything you didn’t want to know… and more! Everything you didn’t want to know… and more!

BLOSUM Information Resources Algorithms in Computational Biology Spring 2006 Created by Itai Sharon.

Lecture 1. Microorganisms: an overview Chapter 1. Microorganisms and Microbiology Chapter 2. An overview of microbial life. Cell and viral structures DNA.

Tools: Amino acid sequences (PDB, EBI) from many diverse organisms to be provided for students to select about 5-6 organisms representing the three domains.

1/17 Identification of thermophilic species by the amino acid compositions deduced from their genomes Reporter: Yu Lun Kuo

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

1 LSM2241 AY0910 Semester 2 MiniProject Briefing Round 5.

Discovering the Correlation Between Evolutionary Genomics and Protein-Protein Interaction Rezaul Kabir and Brett Thompson

Secondary structure prediction

Construction of Substitution Matrices

Calculating branch lengths from distances. ABC A B C----- a b c.

Homology modelling of serine proteases Roland J. Siezen Industrial examples.

Jacek Leluk, Interdisciplinary Centre for Mathematical and Computational Modelling, Warsaw University CLASSIFICATION AND CHARACTERIZATION OF NATURAL PROTEIN.

Amino Acid Sequences in V3 Loop Conformation Alex Cardenas, Bobby Arnold and Zeb Russo Loyola Marymount University Department of Biology BIO /02/11.

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

SATMathVideos.Net A set S consists of all multiples of 4. Which of the following sets are contained within set S? A) S2 only B) S4 only C) S2 and S4 D)

Hyperthermophile subtilases

Protein Sequence Alignment Multiple Sequence Alignment

Supplemental Figure 1 GhCWIN1 (1) Atßfruct2 (1) Lin6 (1) NtCWIN1 (1) OsCWIN1 (1) ZmCWIN1 (1) Atßfruct4 (1) GhVIN1 (1) GhCWIN1 (45) Atßfruct2 (45) Lin6.

Universal Tree of Life  Universal tree ids the roadmap of life. It depicts the evolutionary history of the cells of all organism and the criteria reveals.

Residue Sequence and Structure in the Re evaluation the Categorization of HIV Progression in Subjects Based on CD4 T cell Decline Rates Angela Garibaldi.

Graphical representation of an amino acid or nucleic acid multiple sequence alignment developed by Tom Schneider and Mike.

Protein Structure and Function. Proteins are organic compounds made from amino acids held together by peptide bonds.

Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Arginine, who are you? Why so important?. Release 2015_01 of 07-Jan-15 of UniProtKB/Swiss-Prot contains sequence entries, comprising

Sequence similarity, BLAST alignments & multiple sequence alignments

Culturing Microorganisms

Structural and sequence features of beta-turns in beta-hairpins

Recombination Hotspot

Survey of Microorganisms

Supporting Figure S4 (A) (B) (C) LOC_Os03G04630 LOC_Os03G04640

Protein Sequence Alignments

Figure 3.14A–D Protein structure (layer 1)

There are four levels of structure in proteins

Comparative functional genomics of mammalian DNA methyltransferases

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Aligning Sequences You have learned about: Data & databases Tools

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

CSPs contain a conserved CSD

Sequence Based Analysis Tutorial

It og Sundhed Thomas Nordahl Petersen, Associate Professor

A. Papa, K. Dumaidi, F. Franzidou, A. Antoniadis

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

It og Sundhed Thomas Nordahl Petersen, Associate Professor

Where would you draw the polyA tail in the gene above?______________

What organisms based on oxygen requirements produce the enzyme SOD?

Chapter 18 Naturally Occurring Nitrogen-Containing Compounds

Phylogenetic analysis of PurR from low-GC Gram-positive bacteria.

Luis Sanchez-Pulido, John F.X. Diffley, Chris P. Ponting

Protein domains Jasmin sutkovic

Volume 19, Issue 1, Pages (January 2011)

Mutation screening of the RYR1-cDNA from peripheral B-lymphocytes in 15 Swedish malignant hyperthermia index cases M. Broman, A. Gehrig, G. Islander,

What organisms based on oxygen requirements produce the enzyme SOD?

Thomas Nordahl Petersen, Associate Prof, Food DTU

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

“When you understand the amino acids,

Characterization of the ERα-UBS.

Phylogenetic analysis and domain structure of CALM proteins.

Thomas Nordahl Petersen, Associate Bioinformatics, DTU

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

GLUTAMINASE - Phylogenetic tree construction - The amino acid Cys (C) was found to be statistically significant in mesophilic bacteria as compared to the abundance of this amino acid in extremophilic bacteria - Statistical analysis revealed GRAVY to be high in thermophilic (2.29 fold) and psychrophilic bacteria (3.3 fold) as compare to mesophilic bacteria - Phylogenetic tree construction - Grouped the glutaminases into their respective classes: - Mesophiles -Thermophiles - Psychrophiles - Halophiles -Sequences representing L-glutaminase from extremophiles were analyzed -Physico-chemical properties were studied to relate these observed differences to their extremophilic properties - Multiple sequence alignment revealed the domain/motif for glutaminases - Domain/ motif consisted of Ser- 74, Lys-77, Asn-126, Lys-268, and Ser-269, which is conserved in all microorganisms GLUTAMINASE