Regions of sequence homology across dominant clones in TLR7tg animals.

Slides:

Advertisements

Similar presentations

Overlap of the human CD8 + T cell receptor repertoire Harlan S. Robins 1,2, SK Srivastava 1, P Campregher 1, CJ Turtle 1, J Andriesen 2, SR Riddell 1,

Advertisements

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

By drawing a picture describe the flow of genetic information from DNA to a protein.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Volume 130, Issue 4, Pages (April 2006)

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Volume 88, Issue 5, Pages (March 1997)

GC TFH cells exhibit HIV antigen–driven clonal expansion and selection

by Nancy D. Borson, Martha Q. Lacy, and Peter J. Wettstein

by David W. Bahler, John A. Miklos, and Steven H. Swerdlow

Nienke van der Stoep, James R Gorman, Frederick W Alt Immunity

by Takashi Kasukabe, Junko Okabe-Kado, and Yoshio Honma

Volume 133, Issue 1, Pages (July 2007)

Characterizing Class I WW domains defines key specificity determinants and generates mutant domains with novel specificities Jeremy Kasanov, Gregorio.

Tiago R. Matos, Menno A. de Rie, Marcel B.M. Teunissen

by Christian H. Ottensmeier, and Freda K. Stevenson

IgA and IgM VH repertoires in human colon: Evidence for clonally expanded B cells that are widely disseminated Wolfgang Holtmeier, Andreas Hennemann,

Demonstration That Mast Cells, T Cells, and B Cells Bearing the Activating Kit Mutation D816V Occur in Clusters within the Marrow of Patients with Mastocytosis

Characterizing Class I WW domains defines key specificity determinants and generates mutant domains with novel specificities Jeremy Kasanov, Gregorio.

Deficiency of somatic hypermutation of the antibody light chain is associated with increased frequency of severe respiratory tract infection in common.

Volume 119, Issue 4, Pages (October 2000)

Antigen-specific TCRβ clonotypes map to the TCRβ repertoire at markedly different frequencies. Antigen-specific TCRβ clonotypes map to the TCRβ repertoire.

Durbaka V.R Prasad, Sabrina Richards, Xoi Muoi Mai, Chen Dong Immunity

Volume 44, Issue 4, Pages (November 2004)

Volume 4, Issue 1, Pages (January 1996)

Volume 84, Issue 3, Pages (February 1996)

Antigenic Variation in Lyme Disease Borreliae by Promiscuous Recombination of VMP- like Sequence Cassettes Jing-Ren Zhang, John M Hardham, Alan G Barbour,

Figure 1. Generation of the S250F Aadc mutant mice

Variable CDR3 lengths support the notion of oligoclonality in CD8+ T cells of lupus-prone mice. Variable CDR3 lengths support the notion of oligoclonality.

The Mouse Spo11 Gene Is Required for Meiotic Chromosome Synapsis

The CD8+ T cell repertoire is largely similar between the spleen and brain of the same lupus-prone animal. The CD8+ T cell repertoire is largely similar.

Isolating CD8+ T cells from lupus-prone mice.

Highly variable VDJβ gene usage in lupus-prone CD8+ T cells.

Volume 19, Issue 2, Pages (August 2003)

CD8+ T cells from lupus-prone mice demonstrate substantial oligoclonality. CD8+ T cells from lupus-prone mice demonstrate substantial oligoclonality. (A–D)

Volume 88, Issue 5, Pages (March 1997)

A Novel Family of Candidate Pheromone Receptors in Mammals

Volume 130, Issue 4, Pages (April 2006)

A Molecular Map of T Cell Development

Phylogenetic tree of perA A2-domain DNA sequence.

Volume 12, Issue 5, Pages (May 2000)

MicroRNA Control in the Immune System: Basic Principles

Volume 11, Issue 19, Pages (October 2001)

Alpha-B Crystallin Gene (CRYAB) Mutation Causes Dominant Congenital Posterior Polar Cataract in Humans Vanita Berry, Peter Francis, M. Ashwin Reddy,

Volume 15, Issue 6, Pages (December 2001)

Volume 48, Issue 2, Pages e7 (February 2018)

High-throughput sequencing of the B-cell receptor in African Burkitt lymphoma reveals clues to pathogenesis by Katharine A. Lombardo, David G. Coffey,

Immunopathology in RSV Infection Is Mediated by a Discrete Oligoclonal Subset of Antigen-Specific CD4+ T Cells Steven M Varga, Xiaoting Wang, Raymond.

The Shaping of the T Cell Repertoire

Identification of mouse AAV capsid-specific CD8+ T cell epitopes

Identification of the GCS1 ortholog in Gonium pectorale.

The Gene Mutated in Variant Late-Infantile Neuronal Ceroid Lipofuscinosis (CLN6) and in nclf Mutant Mice Encodes a Novel Predicted Transmembrane Protein

Molecular Genetics of the Caveolin Gene Family: Implications for Human Cancers, Diabetes, Alzheimer Disease, and Muscular Dystrophy Jeffrey A. Engelman,

Role of the amino-terminal domain of simian virus 40 early region in inducing tumors in secretin-expressing cells in transgenic mice Christelle Ratineau,

Expression of multiple forms of MEL1 gene products.

Detection of neoantigen-specific T cell recognition in cancer.

The C2H2 zinc-finger factor ztf-16 is required for ver-1 expression.

Epiplakin binds to keratins via multiple sites.

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Mutation of the Ca2+ Channel β Subunit Gene Cchb4 Is Associated with Ataxia and Seizures in the Lethargic (lh) Mouse Daniel L Burgess, Julie M Jones,

Volume 13, Issue 1, Pages (July 2000)

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

IL‐7‐dependent compositional changes within the γδ T cell pool in lymph nodes during ageing lead to an unbalanced anti‐tumour response The diversity of.

Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon Insertion in the Candidate Gene. Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon.

Mutations in the Human Orthologue of the Mouse underwhite Gene (uw) Underlie a New Form of Oculocutaneous Albinism, OCA4 J.M. Newton, Orit Cohen-Barak,

Convergent expansion in less predominant B-lineage clones.

Ten most frequent TCRs in the bulk 12TILs comprise >99% of the TIL population, and the neoantigens are shown to be the most dominant clones. Ten most frequent.

Volume 15, Issue 6, Pages (December 2001)

A, Schematic diagram of identified splice variants of PD-L1.

Sequence alignment of colicin lysis proteins.

Presentation transcript:

Regions of sequence homology across dominant clones in TLR7tg animals. Regions of sequence homology across dominant clones in TLR7tg animals. (A and B) The CDR3 sequence of the dominant CD8+ T cell clone isolated from the brain of each TLR7tg (n = 8) (A) or spleen of each wild type B6 (n = 8) (B) mouse is shown. The frequency at which each of these top clones appears across all animals is presented. (C) CDR3 alignment along with V, D, and J gene usage for each top clone in TLR7tg or wild type B6 mice. An asterisk (*) indicates an instance in which multiple nucleotide sequences encoding different Vβ genes generated identical CDR3 amino acid sequences. Peter A. Morawski, and Silvia Bolland ImmunoHorizons 2019;3:61-70 ©2019 by American Association of Immunologists