Point Specific Alignment Methods

Slides:



Advertisements
Similar presentations
Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.
Advertisements

Statistics in Bioinformatics May 2, 2002 Quiz-15 min Learning objectives-Understand equally likely outcomes, Counting techniques (Example, genetic code,
Gapped BLAST and PSI-BLAST Altschul et al Presenter: 張耿豪 莊凱翔.
BLAST Sequence alignment, E-value & Extreme value distribution.
Gapped Blast and PSI BLAST Basic Local Alignment Search Tool ~Sean Boyle Basic Local Alignment Search Tool ~Sean Boyle.
Measuring the degree of similarity: PAM and blosum Matrix
Lecture 8 Alignment of pairs of sequence Local and global alignment
Bioinformatics Finding signals and motifs in DNA and proteins Expectation Maximization Algorithm MEME The Gibbs sampler Lecture 10.
Heuristic alignment algorithms and cost matrices
Expect value Expect value (E-value) Expected number of hits, of equivalent or better score, found by random chance in a database of the size.
Multiple sequence alignment Conserved blocks are recognized Different degrees of similarity are marked.
Introduction to bioinformatics
Sequence similarity.
Alignment methods June 26, 2007 Learning objectives- Understand how Global alignment program works. Understand how Local alignment program works.
Similar Sequence Similar Function Charles Yan Spring 2006.
Sequence Alignment III CIS 667 February 10, 2004.
Multiple sequence alignment Conserved blocks are recognized Different degrees of similarity are marked.
BLAST.
Point Specific Alignment Methods
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Rationale for searching sequence databases June 22, 2005 Writing Topics due today Writing projects due July 8 Learning objectives- Review of Smith-Waterman.
Sequence alignment, E-value & Extreme value distribution
Introduction to Bioinformatics From Pairwise to Multiple Alignment.
Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.
Statistics in Bioinformatics May 12, 2005 Quiz 3-on May 12 Learning objectives-Understand equally likely outcomes, counting techniques (Example, genetic.
Gapped BLAST and PSI-BLAST : a new generation of protein database search programs Team2 邱冠儒 黃尹柔 田耕豪 蕭逸嫻 謝朝茂 莊閔傑 2014/05/12 1.
An Introduction to Bioinformatics
Protein Sequence Alignment and Database Searching.
Gapped BLAST and PSI- BLAST: a new generation of protein database search programs By Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
Scoring Matrices April 23, 2009 Learning objectives- 1) Last word on Global Alignment 2) Understand how the Smith-Waterman algorithm can be applied to.
Local alignment, BLAST and Psi-BLAST October 25, 2012 Local alignment Quiz 2 Learning objectives-Learn the basics of BLAST and Psi-BLAST Workshop-Use BLAST2.
Database Searches BLAST. Basic Local Alignment Search Tool –Altschul, Gish, Miller, Myers, Lipman, J. Mol. Biol. 215 (1990) –Altschul, Madden, Schaffer,
Comp. Genomics Recitation 3 The statistics of database searching.
Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.
Bioinformatics Ayesha M. Khan 9 th April, What’s in a secondary database?  It should be noted that within multiple alignments can be found conserved.
Tutorial 4 Substitution matrices and PSI-BLAST 1.
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
BLAST Slides adapted & edited from a set by Cheryl A. Kerfeld (UC Berkeley/JGI) & Kathleen M. Scott (U South Florida) Kerfeld CA, Scott KM (2011) Using.
Rationale for searching sequence databases June 25, 2003 Writing projects due July 11 Learning objectives- FASTA and BLAST programs. Psi-Blast Workshop-Use.
Pairwise Sequence Alignment Part 2. Outline Summary Local and Global alignments FASTA and BLAST algorithms Evaluating significance of alignments Alignment.
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
Point Specific Alignment Methods PSI – BLAST & PHI – BLAST.
Doug Raiford Lesson 5.  Dynamic programming methods  Needleman-Wunsch (global alignment)  Smith-Waterman (local alignment)  BLAST Fixed: best Linear:
Sequence Alignment.
Construction of Substitution matrices
Doug Raiford Phage class: introduction to sequence databases.
Blast 2.0 Details The Filter Option: –process of hiding regions of (nucleic acid or amino acid) sequence having characteristics.
Step 3: Tools Database Searching
©CMBI 2005 Database Searching BLAST Database Searching Sequence Alignment Scoring Matrices Significance of an alignment BLAST, algorithm BLAST, parameters.
V diagonal lines give equivalent residues ILS TRIVHVNSILPSTN V I L S T R I V I L P E F S T Sequence A Sequence B Dot Plots, Path Matrices, Score Matrices.
V diagonal lines give equivalent residues ILS TRIVHVNSILPSTN V I L S T R I V I L P E F S T Sequence A Sequence B Dot Plots, Path Matrices, Score Matrices.
BLAST: Database Search Heuristic Algorithm Some slides courtesy of Dr. Pevsner and Dr. Dirk Husmeier.
Using BLAST To Teach ‘E-value-tionary’ Concepts Cheryl A. Kerfeld 1, 2 and Kathleen M. Scott 3 1.Department of Energy-Joint Genome Institute, Walnut Creek,
Substitution Matrices and Alignment Statistics BMI/CS 776 Mark Craven February 2002.
9/6/07BCB 444/544 F07 ISU Dobbs - Lab 3 - BLAST1 BCB 444/544 Lab 3 BLAST Scoring Matrices & Alignment Statistics Sept6.
Database Scanning/Searching FASTA/BLAST/PSIBLAST G P S Raghava.
Sequence similarity, BLAST alignments & multiple sequence alignments
Identifying templates for protein modeling:
Fast Sequence Alignments
BLAST.
Basic Local Alignment Search Tool
Basic Local Alignment Search Tool (BLAST)
Basic Local Alignment Search Tool
BLAST Slides adapted & edited from a set by
Sequence alignment, E-value & Extreme value distribution
BLAST Slides adapted & edited from a set by
1-month Practical Course Genome Analysis Iterative homology searching
Presentation transcript:

Point Specific Alignment Methods PSI – BLAST & PHI – BLAST

In order to control the quality of the sequence matches in a BLAST search controls are placed on the E – value of the result. The Expect value (E) is a parameter that describes the number of hits one can "expect" to see just by chance when searching a database of a particular size. It decreases exponentially with the Score (S) that is assigned to a match between two sequences. Essentially, the E value describes the random background noise that exists for matches between sequences. For example, an E value of 1 assigned to a hit can be interpreted as meaning that in a database of the current size one might expect to see 1 match with a similar score simply by chance. This means that the lower the E-value, or the closer it is to "0" the more "significant" the match is. However, keep in mind that searches with short sequences, can be virtually indentical and have relatively high E-value. This is because the calculation of the E-value also takes into account the length of the Query sequence. This is because shorter sequences have a high probability of occurring in the database purely by chance. One criticism of this type of control is that sequences having basically the same functionality may be missed in the search since they score over the threshold value. Here is one possible cure: The Expect value can also be used as a convenient way to create a significance threshold for reporting results. You can change the Expect value threshold on most main BLAST search pages. When the Expect value is increased from the default value of 10, a larger list with more low-scoring hits can be reported.

Another strategy is to change the reward/penalty ratio in the scoring system. Many nucleotide searches use a simple scoring system that consists of a "reward" for a match and a "penalty" for a mismatch. The (absolute) reward/penalty ratio should be increased as one looks at more divergent sequences. A ratio of 0.33 (1/-3) is appropriate for sequences that are about 99% conserved; a ratio of 0.5 (1/-2) is best for sequences that are 95% conserved; a ratio of about one (1/-1) is best for sequences that are 75% conserved. On the other hand, if we become too liberal in expanding these parameters, or change ratios without reason, we find that we can find matches for almost any sequence. For example, consider the amino acid sequence (V was used in place of U): CVTTHESTEAKWITHASHARPKNIFEELSESTRINGYMEATWILLRESULT We will use the protien – protein BLAST for short sequences using a non-redundant database, an Expect Value of 20 and the PAM30 matrix and the Smith-Wateman algorithm. We get 37 matches for this nonsense sequence. The highest scoring match has an E-value of 1.3 gi|121705510|ref|XP_001271018.1| C6 transcription factor, put... 34.6 1.3 gi|58583535|ref|YP_202551.1| HmsF [Xanthomonas oryzae pv. ory... 33.7 2.3 gi|84625349|ref|YP_452721.1| HmsF protein [Xanthomonas oryzae... 33.7 2.3 gi|123445879|ref|XP_001311695.1| hypothetical protein TVAG_49... 32.9 4.2 gi|123469845|ref|XP_001318132.1| helicase, putative [Trichomo... 32.5 5.6 gi|118032193|ref|ZP_01503644.1| conserved hypothetical protei... 32.5 5.6

>gi|121705510|ref|XP_001271018.1| C6 transcription factor, putative [Aspergillus clavatus NRRL 1] gi|119399164|gb|EAW09592.1| C6 transcription factor, putative [Aspergillus clavatus NRRL 1] Length=887 Score = 34.6 bits (74), Expect = 1.3 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 9/32 (28%) Query 26 EE---LSESTRINGYM----EATWI--LLRES 48 EE L+ES+R GYM E TW+ L RES Sbjct 223 EEDLNLTESSRATGYMGKNSELTWMQRLQRES 254 >gi|58583535|ref|YP_202551.1| HmsF [Xanthomonas oryzae pv. oryzae KACC10331] gi|58428129|gb|AAW77166.1| HmsF protein [Xanthomonas oryzae pv. oryzae KACC10331] Length=663 Score = 33.7 bits (72), Expect = 2.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 14/41 (34%) Query 18 HARP--KNIFEELSESTRINGYMEATWIL------LRESVL 50 AR K+I+E+L+ IN YME IL LR++ L Sbjct 460 QARQIIKDIYEDLA----INSYMEG--ILFHDDGYLRDTEL 494

Even using Local Sequence Alignment Techniques and Scoring Matrices such as high powers of PAM or low values of BLOSUMn Database Searching may not find what we want. Many homologous sequences share only limited sequence identity. While they may adopt the same three-dimensional structure, they may not have apparent similarity in pair wise alignments. Cases are known where BLAST and FASTA miss 10 – 20% of “meaningful” hits. Scoring matrices do not accurately portray the similarity that may exist within a particular family of proteins. They are tied to a more general database.

In an attempt to correct this the idea of a Position Specific Scoring Matrix (PSSM) was developed. In PSI-BLAST the query sequence is subjected to a normal BLAST search. From this a multiple-sequence alignment is made between the query and all “significant” hits. A new scoring matrix of size L rows and 20 columns is derived using the frequency of the proteins within each position of the alignment. (L is the length of the query sequence.)

The previous example was taken from Pevsner, J., Bioinformatics and Functional Genomics, Wiley-LISS, 2003, p139 And involves a search with Query sequence RBP4 (NP_006735) Here is a portion of the PSSM generated by Pevsner’s Search Note Lines 6, 11, 12, 14, 15, 16, and 42 all of which are scores for A against the 20 proteins.

The PSSM is then used as the query (not your original sequence) to the database and another search to the database. The statistical significance of each match is estimated and results are reported. These last three steps are repeated iteratively until no new sequences are reported that fall above the given significance level or the user chooses to terminate the search.

A Schemematic of the PSI-Blast Process Note the original query is not included in loop 2.

Pevsner reported the following data concerning his 2002 search with original query NP_006735 At this point we will do an update of these results by going to http://www.ncbi.nlm.nih.gov/blast and choosing the PSI-BLAST option with the default parameters.

A Dramatic Illustration of the Increased Sensitivity ot PSI-BLAST Searching

PHI-BLAST stands for Pattern-Hit Initiated BLAST Often it is the case that a protein of interest contains a signature pattern of amino acids and residues that help to define it as part of the family. This “signature” may be rather short in terms of its length within the sequence, but it is important in defining a structural of functional domain. It may even be the characteristic of an unknown function as is the case in the following example:

Care must be taken to choose a pattern that is not common within the database. The algorithm only allows patterns that are expected to occur at most once in every 5000 residues. In the previous example the pattern is GXW where the X may be any amino acid. Then we specify candidates for the following amino acids [YF], [EA], or [IVLM]. These choices are based on our observation of the test sequences and our knowledge of the behavior of proteins (common protein substitutions, hydrophobicity, etc.) The database search is then performed looking for sequences that contain the prescribed pattern. Further iterations may be done based on this output using PSI-BLAST which no longer uses the PHI pattern, but the PSSM from the first report.

The output from the PHI-BLAST program is the same as that of the PSI-BLAST program except that the position of the pattern is highlighted in each of the alignments .

The following alignment was obtained from an investigation of immunoglobulin C-Region Domains: We will investigate the conserved sequence: LXCLV using PHI-BLAST. Our starting point is with the Ig 2A C region of the mouse, SwissProt Accession #P01865 We enter this information into the PHI-BLAST page

The first iteration of this search yields 31 new statistically significant hits. One of these is given below. Note the *’s over the location of the pattern LXCLV Subsequent iterations are performed by PSI-BLAST independent of the pattern. This search converged after 13 iterations.