Olivier Poirot, Eamonn O'Toole and Cedric Notredame

Slides:

Advertisements

Similar presentations

Nucleic Acids Nucleic Acid Basics Contain instructions to build proteins 2 types: – DNA – RNA Composed of smaller units called nucleotides – Monomer:

Advertisements

Clustal W and Clustal X version 2.0 김영호, 박준호, 최현희 The 9 th Protein Folding Winter School.

Bioinformatics resources for IITA Crops GO Workshop 3-6 August 2010.

Structural bioinformatics

Progressive Combinatorial Algorithm for Multiple Structural Alignments:Application to Distantly Related Proteins Maria Elena Ochagavia and Shoshana Wodak.

Chromosomes carry genetic information

A Novel Third Isoform of Zebrafish Cytochrome Oxidase IV Brandon Smith Dr. Nancy Bachman, Faculty Advisor.

Sequence Analysis. DNA and Protein sequences are biological information that are well suited for computer analysis Fundamental Axiom: homologous sequences.

3D-COFFEE Mixing Sequences and Structures Cédric Notredame.

Multiple sequence alignment

Cédric Notredame (30/08/2015) Chemoinformatics And Bioinformatics Cédric Notredame Molecular Biology Bioinformatics Chemoinformatics Chemistry.

Wellcome Trust Workshop Working with Pathogen Genomes Module 3 Sequence and Protein Analysis (Using web-based tools)

The BioBox Initiative: Bio-ClusterGrid Gilbert Thomas Associate Engineer Sun APSTC – Asia Pacific Science & Technology Center.

Coffee Shop F 黃仁暐 F 戴志華 F 施逸優 R 吳於芳 R 林與絜.

Content of the previous class Introduction The evolutionary basis of sequence alignment The Modular Nature of proteins.

Multiple Sequence Alignments  Assemble DNA sequences into a ‘contig’  Identify conserved residues and domains.

Using Mixed Length Training Sequences in Transcription Factor Binding Site Detection Tools Nathan Snyder Carnegie Mellon University BioGrid REU 2009 University.

Using the feature color file (.fc) and fasta file to create figures (ATOH7 example) Using the feature color file (.fc) and fasta file to create figures.

Protein Folding Programs By Asım OKUR CSE 549 November 14, 2002.

Using the T-Coffee Multiple Sequence Alignment Package I - Overview Cédric Notredame Comparative Bioinformatics Group Bioinformatics and Genomics Program.

What is Genetic Research?. Genetic Research Deals with Inherited Traits DNA Isolation Use bioinformatics to Research differences in DNA Genetic researchers.

Multiple sequence alignments Introduction to Bioinformatics Jacques van Helden Aix-Marseille Université (AMU), France Lab.

Construction of Substitution Matrices

BioPerf: A Benchmark Suite to Evaluate High- Performance Computer Architecture on Bioinformatics Applications David A. Bader, Yue Li Tao Li Vipin Sachdeva.

Integrating Biological Information In Multiple Sequence Alignments Confronting Bits and Pieces of Information Cédric Notredame CNRS-Marseille, France

Chapter 3 Computational Molecular Biology Michael Smith

ARE THESE ALL BEARS? WHICH ONES ARE MORE CLOSELY RELATED?

1 Phylogeny Workshop By Eyal PrivmanEyal Privman The Bioinformatics Unit G.S. Wise Faculty of Life Science Tel Aviv University, Israel November 2009

Multiple sequence alignment

Bioinformatics Scheme of the sequencing project (Martínez & Figueras, 2007) Construction Bookseller Bases determination Fragments assembly Gene search.

Classifying MSA Packages Multiple Sequence Alignments in the Genome Era Cédric Notredame Information Génétique et Structurale CNRS-Marseille, France.

Basic Local Alignment Search Tool BLAST Why Use BLAST?

Database search. Overview ： 1. FastA ： is suitable for protein sequence searching 2. BLAST ： is suitable for DNA, RNA, protein sequence searching.

From basic Concepts to Advanced applications Molecular Evolution & Phylogeny By Ofir Cohen The Bioinformatics Unit G.S. Wise Faculty of Life Science Tel.

Biocomputation: Comparative Genomics Tanya Talkar Lolly Kruse Colleen O’Rourke.

Techniques for Protein Sequence Alignment and Database Searching (part2) G P S Raghava Scientist & Head Bioinformatics Centre, Institute of Microbial Technology,

ARGOS (A Replicable Genome InfOrmation System) for FlyBase and wFleaBase Don Gilbert, Hardik Sheth, Vasanth Singan { gilbertd, hsheth, vsingan

Aligning Sequences With T-Coffee Cédric Notredame Comparative Bioinformatics Group Bioinformatics and Genomics Program.

Wrapping analytical services for caBIG Taverna-caGrid technical review meeting Stian Soiland-Reyes, myGrid University of Manchester, UK

Construction of Substitution matrices

Hidden Markov Model and Its Application in Bioinformatics Liqing Department of Computer Science.

T-COFFEE, a novel method for Multiple Sequence Alignments Cédric Notredame.

Copyright OpenHelix. No use or reproduction without express written consent1.

1 Multiple Sequence Alignment(MSA). 2 Multiple Alignment Number of sequences >2 Global alignment Seek an alignment that maximizes score.

Summer Bioinformatics Workshop 2008 BLAST Chi-Cheng Lin, Ph.D., Professor Department of Computer Science Winona State University – Rochester Center

Gene_identifier color_no gtm1_mouse 2 gtm2_mouse 2 >fasta_format_description_line >GTM1_HUMAN GLUTATHIONE S-TRANSFERASE MU 1 (GSTM1-1) PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI.

Last Class Protein Protein Carbohydrate Carbohydrate Lipid Lipid Nucleic acid Nucleic acid.

T-COFFEE, a novel method for combining biological information Cédric Notredame.

Dr. Abdelkrim Rachedi. 1. General introduction to bioinformatics. 2. Databases in biology: -> 2.1. Databases for the primary structure of Proteins and.

PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.

Aligning Kinases Applying MSA Analysis to the CDK family.

July LJM Introduction to Bioinformatics Lisa Mullan, HGMP-RC.

Pairwise alignment Now we know how to do it: How do we get a multiple alignment (three or more sequences)? Multiple alignment: much greater combinatorial.

Konstantin Okonechnikov Qualimap v2: advanced quality control of

Multiple Sequence Alignment

ncRNA Multiple Alignments with R-Coffee

Pairwise and NGS read alignment

From: Computational analysis of bacterial RNA-Seq data

חיזוי ואפיון אתרי קישור של חלבון לדנ"א מתוך הרצף

Converting DNA Sequence file formats with BioPython

אוניברסיטת בר אילן פרוייקט גמר- ביולוגיה חישובית

Bioinformatics Vicki & Joe.

Maximize read usage through mapping strategies

Basic Local Alignment Search Tool (BLAST)

T-Coffee: What’s New in The Grinder

Schematic representation of a transcriptomic evaluation approach.

SUBMITTED BY: DEEPTI SHARMA BIOLOGICAL DATABASE AND SEQUENCE ANALYSIS.

Presentation transcript:

Tcoffee@igs: a web server for computing, evaluating and combining multiple sequence alignments Olivier Poirot, Eamonn O'Toole and Cedric Notredame Nucleic Acids Research, 31, 3503-3506 (2003) July 22, 2003 Park, Ji-Yoon

Abstract Tcoffee@igs Web-based tool to the computation, the evaluation & combination of multiple alignment The latest version of the T-Coffee package Provided by Hewlet Packard & Centre National de la Recherche Scientifique Can be used for align protein, RNA or DNA 100 sequences (2,000 residues long) process available

Related Publication T-Coffee: A novel method for multiple sequence alignments. C.Notredame, D. Higgins, J. Heringa,Journal of Molecular Biology,Vol 302, pp205-217,2000 [pdf] COFFEE: A New Objective Function For Multiple Sequence Alignmnent. C. Notredame, L. Holme and D.G. Higgins, Bioinformatics,Vol 14 (5) 407-422,1998 [pdf]

http://igs-server.cnrs-mrs.fr/

Tcoffee

Methods Multiple sequence alignment assembly - Given a set of pre-selected protein or DNA seq, computes a multiple seq alignment of the input sequences - By computing a collection of pair-wise alignment [ the best global alignment & 10 best local alignment ] - The highest level of consistency with alignment within the library Computing a multiple alignment - FASTA form sequence Evaluating a multiple alignment - evaluate pre-computed multiple sequence alignment IV. Combine multiple alignments

Output of T-Coffee Computation

Colored Output of T-Coffee

Conclusion & Future Developments Tcoffee@igs A new multiple sequence alignment server To produce high quality multiple sequence alignment Further development - Enhanced regarding the mixing of sequences & structure