Copper‐binding conformations and PrP octarepeat sequence mutations The structure of full‐length PrP and derivative C1 and C2 fragments with an enlarged.

Slides:



Advertisements
Similar presentations
MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.
Advertisements

The effect of amino acid substitution in the kinase inhibitory region of JAB. (A) Unchanged amino acids are shown as dots, substituted amino acids by a.
(A, B) Stereoscopic views of the P3 RNase MRP RNA domain in complex with the RNase MRP/RNase P protein components Pop6 and Pop7. (A, B) Stereoscopic views.
Yeast Tgl3p expressed in HeLa cells localizes to lipid droplets.
Expression analyses of KLK7 mRNA in the brains of AD patients
Morphological analyses of peripheral blood and bone marrow cells isolated from leukemic mice. Morphological analyses of peripheral blood and bone marrow.
Structure of the Human Telomerase RNA Pseudoknot Reveals Conserved Tertiary Interactions Essential for Function  Carla A. Theimer, Craig A. Blois, Juli.
Multiple sequence alignment of the BAR domains from Amphiphysins and from the subset of BAR domain family members that were shown to bind to a small GTPase.
Features of the helicase region of RecQΔC.
AAV8‐hAAT‐FGF21 treatment improves liver fibrosis
CAR T cell dose and percentages of CAR‐positive cells within CAR T cell products CAR T cell dose and percentages of CAR‐positive cells within CAR T cell.
Dual LGR5 and KI67 knock‐in PDOs enable separation of quiescent and cycling LGR5+ CRC cells Dual LGR5 and KI67 knock‐in PDOs enable separation of quiescent.
Metabolic profile of Tfe3 KO mice
Structure of the Human Telomerase RNA Pseudoknot Reveals Conserved Tertiary Interactions Essential for Function  Carla A. Theimer, Craig A. Blois, Juli.
Phenogenetic networks of genes linked to Alzheimer's and Parkinson's disease reveal concordant phenotypes Phenogenetic networks of genes linked to Alzheimer's.
FOXO3 is phosphorylated by cyclin D3/CDK6 complex on S325
Structure Prediction: How good are we?
Phosphorylation of a tyrosine residue in mGluR1a-CT1 by Fyn.
Clinical testing of calcineurin inhibitors cyclosporine A and tacrolimus in autoimmune disorders Clinical testing of calcineurin inhibitors cyclosporine.
No neurodegenerative phenotype observed in single Aph1a and Aph1bc cKO Cre+ mice No neurodegenerative phenotype observed in single Aph1a and Aph1bc cKO.
Effects of GM1 on astroglial and microglial markers
Modules with causal links to ALS are associated with inflammation and enriched with TDP‐43 protein–protein interactions (PPIs)‏ Modules with causal links.
KLK7 is involved in the Aβ degradation activity
Expression of PD‐1 on PBMC and malignant exudate T cells
The upstream region of MUC5AC bound by SPDEF is required for the expression of MUC5AC in human lung cancer cells The upstream region of MUC5AC bound by.
Expression and occupancy of a set of transcription factors corresponding to the identified motifs at FAIRE peaks Expression and occupancy of a set of transcription.
Putative pathogenic variants in KLB identified in congenital hypogonadotropic hypogonadism Putative pathogenic variants in KLB identified in congenital.
Heat maps showing global relative growth phenotype and comparison between measured and predicted values. Heat maps showing global relative growth phenotype.
Stromal fibromuscular AR regulates epithelium proliferation, ECM remodelling, neovasculature formation and immune cell infiltration in Pten deficient mice.
Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2
Hung-Ta Chen, Steven Hahn  Cell 
Mutants of the Group III have differentially impaired induction of pAGA1 and pFIG1 Mutants of the Group III have differentially impaired induction of pAGA1.
GTSF1 interacts with PIWI protein complexes
Nec‐1 inhibits the phosphorylation and aggregation of tau
Bisection mapping of T7. RNAP
Association of AIM2, RIG‐I and NLRP3 inflammasomes with better survival in NPC patients.A.Overexpression of ASC, caspase‐1 and IL‐1β proteins as well as.
Comparison of mapped epitopes and peptides identified in immuno-SILAC screening of polyclonal antibodies against trypsin-digested PrESTs. Comparison of.
Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.
Normal priming and expansion of functional T cells in the spleen during concurrent co‐infection Normal priming and expansion of functional T cells in the.
IL‐23‐induced psoriasis‐like skin disease is ameliorated in IL‐23−/− mice IL‐23‐induced psoriasis‐like skin disease is ameliorated in IL‐23−/− mice ARepresentative.
Photoconversion of the Dendra2 DPR tag generates a red fluorescent DPR that can be longitudinally monitored and demonstrates DPRs have long half‐lives.
Association of total disease burden and disease progression with age‐adjusted blood heteroplasmy Association of total disease burden and disease progression.
Association of total disease burden with age, m
Pt‐GG adducts in the active sites of Dpo4 and ypolη.
Gene targeting of the therapeutic EGFP/PGK‐FANCA donor in the AAVS1 locus of HD CD34+ cells Gene targeting of the therapeutic EGFP/PGK‐FANCA donor in the.
CUL3Δ403–459 displays increased auto‐ubiquitylation and ubiquitylation of KLHL3 A–DIn vitro ubiquitylation assays with purified proteins. CUL3Δ403–459.
Claude Daniel, Stephen Horvath, Paul M Allen  Immunity 
CD44 binding surface of the Tiam2 PHCCEx domain.
Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment.
WES identification of heterozygous compound mutations in ALPI
Scheme of FGF‐dependent regulation of TGFβ signaling in smooth muscle cells and endothelial cells Scheme of FGF‐dependent regulation of TGFβ signaling.
C266S laforin's effect on LD‐associated general defect in autophagy
Features of the LIMT gene and RNA abundance in cell lines of different tissues of origin Features of the LIMT gene and RNA abundance in cell lines of different.
Regulation of RECQ4–MCM10 interaction by CDK phosphorylation.
Characterising dermis expansion and gene expression changes during mouse development (related to Fig 1)‏ Characterising dermis expansion and gene expression.
The antitumor activity of olaparib in PDXs identifies a subset of PARPi‐sensitive tumors The antitumor activity of olaparib in PDXs identifies a subset.
Rescue of motor neurons from death The ventral root of the fifth lumbar segment (L5). Rescue of motor neurons from death The ventral root of the fifth.
Lipid presentation by CD11c+ cells controls iNKT cell subsets
WES identification of heterozygous compound mutations in ALPI
Impact of IRE1 somatic mutations on tumor development
Direct interaction of RECQ4 and MCM10.
DIA1(R1204X) induces elongated and thick microvilli in HeLa cells
GM1 decreases neuropathology and weight loss in R6/2 mice
FGFR1 and TGFβ signaling activity in smooth muscle cells in a mouse atherosclerosis model FGFR1 and TGFβ signaling activity in smooth muscle cells in a.
Tangle formation and downregulation of miR‐132‐3p in LOAD A‐G
Ankyrin domain residues permit activation of LRRK2 by Rab29
The C-terminal membrane-proximal region of MARCH8 interacts with TfR.
Dictyostelium has PS-dependent γ-secretase activity that processes human APP to release Aβ peptides. Dictyostelium has PS-dependent γ-secretase activity.
Mutant TERT promoter displays active histone marks and distinct long-range interactions: A, cell lines that were used in the study with their origin and.
Volume 15, Issue 6, Pages (September 2004)
Presentation transcript:

Copper‐binding conformations and PrP octarepeat sequence mutations The structure of full‐length PrP and derivative C1 and C2 fragments with an enlarged view of the cleavage sites is shown. Copper‐binding conformations and PrP octarepeat sequence mutations The structure of full‐length PrP and derivative C1 and C2 fragments with an enlarged view of the cleavage sites is shown. The C2 (β) site was mapped in HpL3‐4 cells by (Mange et al, 2004). Ragged C1 (α) cleavage sites in brain are shown (Chen et al, 1995), and a dotted arrow indicates that additional sites have been mapped rightward of this position in vitro (McDonald et al, 2014). Ragged N‐terminal cleavage sites of PrP27‐30 from prion‐infected mouse brain are indicated by small arrows (Howells et al, 2008). The positions of antibody epitopes are also shown (residues in brackets). Grey shading reflects the minimum length for a C2 fragment defined operationally by reactivity with 12B2 antibody. S1 and S3 alleles, by virtue of limited geometries (modified from Chattopadhyay et al, 2005), may have access to distinct subsets of the full range of biological activities of WT PrP, which has access to interchangeable component 1, 2 and 3 geometries. Sequences of synthetic PrP alleles differing in the octarepeat region of mouse PrP. Conserved histidines in octarepeats 2–5 are coloured blue and missense mutations are shown in red. Overproduction of C2 fragment is indicated by ++ signs to the right of the panel. Agnes Lau et al. EMBO Mol Med. 2015;emmm.201404588 © as stated in the article, figure or figure legend