Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Slides:

Advertisements

Similar presentations

Xba I kbp Sac I Hind III Fig. S1 Southern blot analysis using genomic DNA from Nona Bokra plants. Five µg of Nona Bokra genomic DNA was.

Advertisements

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Schematic representation of p53 molecule

* * * Fig. S1 XB21-Os12g36180 Os11g43950 At4g12770 At4g

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Stereoview of the structural superposition of IspH protein from E

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

H-NS2 protein interacts with Lon and H-NS protein in vitro.

The dicBF locus is conserved in E. coli species in different prophages

ClustalOmega alignment of FlaC protein sequences.

Debanu Das, Millie M Georgiadis Structure

Evolutionary relationships of H-NS, StpA, and third H-NS paralogues in different members of Enterobacteriaceae. Evolutionary relationships of H-NS, StpA,

Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.

STAT Genes Found in C. elegans

Allosteric site of B. subtilis PRPP synthase.

Where would you draw the polyA tail in the gene above?______________

Amino acid alignment of TprK showing six different sequences in the T

Volume 74, Issue 1, Pages (January 1998)

H-NS2-FLAG expression is upregulated in DMEM and M9 minimal medium and when cells enter the stationary growth phase. H-NS2-FLAG expression is upregulated.

Volume 28, Issue 6, Pages (December 2007)

N-terminal extension of a gene using peptides mapping upstream to an annotated start site. N-terminal extension of a gene using peptides mapping upstream.

Adapted viruses replicate in mismatched miR-122-expressing cells.

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Protein sequence alignment of the NS3 helicase–encoding region of 63 flaviviruses demonstrates conservation of a KIR2DS2-binding peptide. Protein sequence.

Crystal Structure of the p53 Core Domain Bound to a Full Consensus Site as a Self- Assembled Tetramer Yongheng Chen, Raja Dey, Lin Chen Structure Volume.

Mutations in Cohesin Complex Members SMC3 and SMC1A Cause a Mild Variant of Cornelia de Lange Syndrome with Predominant Mental Retardation Matthew A.

Identification of the GCS1 ortholog in Gonium pectorale.

Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding David J. Sidote, Christopher.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

AKAP15 coimmunoprecipitates with CaV1

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Sequence conservation across the Ub-binding sites of human USPs

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Protein sequence alignment of the NS3 helicase–encoding region of 63 flaviviruses demonstrates conservation of a KIR2DS2-binding peptide. Protein sequence.

Patterns of amino acid usage and its GC-content of synonymous codons in 65 nuclear genomes in this study. Patterns of amino acid usage and its GC-content.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

Schematic representation of the domain structures of insect enzymes involved in chitin metabolism. Schematic representation of the domain structures of.

Ostreococcus and virus-host interactions.

Alignment of the fast/developmental and IIM MYH genes.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

General structure of RIFINs and STEVORs

SUR-8, a Conserved Ras-Binding Protein with Leucine-Rich Repeats, Positively Regulates Ras-Mediated Signaling in C. elegans Derek S Sieburth, Qun Sun,

The alignment of P-type ATPase-like domains of TgATPaseP-GC, PfGCα, and PfGCβ with the members of human P4-ATPases. The alignment of P-type ATPase-like.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

(A) Segregation of mutations in TMEM231 in JBTS families.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Mark S. Dunstan, Debraj GuhaThakurta, David. E. Draper, Graeme L. Conn

HADAT1 is a nucleocytoplasmic shuttling protein that is excluded from the nucleolus. hADAT1 is a nucleocytoplasmic shuttling protein that is excluded from.

BnmAbs 3D3 and 2D10 bind RSV G bnmAbs 3D3 and 2D10 bind RSV G (A) Schematic of the RSV G glycoprotein from RSV strain A2, including the.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Alignment of Wt1 genomic regions reveals a highly conserved element upstream of zebrafish wt1a. Alignment of Wt1 genomic regions reveals a highly conserved.

Sequence variation of 16S rRNA gene primer-binding sites.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Conservation of key sequence features and endocytic localisation in TbCALM. Conservation of key sequence features and endocytic localisation in TbCALM.

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Uptake of amino acids by C. albicans.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Epiplakin binds to keratins via multiple sites.

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Selectivity-determining regions

Cecilia P. Sanchez, Paul Horrocks, Michael Lanzer Cell

Hinrich Gronemeyer, Arthur Zelent Cancer Cell

Progesterone receptor (PR)A and PRB isoform receptor domains and post-translational modifications. Progesterone receptor (PR)A and PRB isoform receptor.

Debanu Das, Millie M Georgiadis Structure

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Alignment of H-NS, H-NS2, and StpA amino acid sequences. Alignment of H-NS, H-NS2, and StpA amino acid sequences. H-NS, H-NS2, and StpA sequence alignment showing the conserved amino acid sequence (dark and light gray). The black box shows the consensus sequence. Alignment was performed using the T-Coffee algorithm (https://www.ebi.ac.uk/Tools/msa/tcoffee/). The H-NS, H-NS2, and StpA sequences have been deposited in NCBI under accession numbers WP_001287378.1, WP_001278198.1, and WP_000115383.1, respectively. The light-gray and dark-gray bars above the sequence alignment show, respectively, the N- and C-terminal domains (dimerization/oligomerization and DNA binding domains, respectively). A. Prieto et al. mSystems 2018; doi:10.1128/mSystems.00220-17