Supplemental Figure 1 1 mutation 2 mutations 3 mutations 4 mutations

Slides:

Advertisements

Similar presentations

Supplemental Figure 1 A No. at risk T T T

Advertisements

Mutations. Definition mutation A mutation is a change in an organism’s DNA – Silent mutations are changes that do not result in a change to the organisms.

TSC2 By Samantha Lee. What is it?  Tuberin  TSC1/hamartin  Tumor suppressor (LOH)  41 small exons, 45 kb DNA  5.5 kb mRNA  196 kD.

P247. Figure 9-1 p248 Figure 9-2 p251 p251 Figure 9-3 p253.

Gene Mutations.

Gene Structure and Function

1 Gene – Expression – Mutation - polymorphism. 2 How are genes expressed ? Nucleus Cytoplasm DNA Transcription Poly(A ) Cap Pre-mRNA Splicing Cap Poly(A)

Supplemental Figure 1 The vast majority of alterations are shared between primary and metastatic tumors. Of the 434 total mutations, 344 (79%) were shared.

1 Legend to Supplementary Figure 1. Histograms showing the number of times that each amino acid undergoes: (a) synonymous (b) nonsense and (c) missense.

Mutational analysis of 35 bladder cancer cell lines using RNA-seq.

13-3 Mutations Can be good, bad or nothing!!. What is a mutation? The word is Latin for “to change”. There are 2 types: – 1) Single gene changes – 2)

Chromosome Tumor samplesNormal samples Supplemental Figure 1.

Point Mutations Silent Missense Nonsense Frameshift.

Mutations in DNA changes in the DNA sequence that can be inherited can have negative effects (a faulty gene for a trans- membrane protein leads to cystic.

Copyright © 2006 Pearson Education, Inc., publishing as Benjamin Cummings PowerPoint ® Lecture Slide Presentation prepared by Christine L. Case M I C R.

MUTATIONS No this can’t happen with just mutations.

Date of download: 6/22/2016 Copyright © 2016 American Medical Association. All rights reserved. From: Identification of a Novel TP53 Cancer Susceptibility.

Mutation. What you need to know How alteration of chromosome number or structurally altered chromosomes can cause genetic disorders How point mutations.

A change in the nucleotide sequence of DNA Ultimate source of genetic diversity Gene vs. Chromosome.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Protein Synthesis. One Gene – One Enzyme Protein Synthesis.

DNA/GENE MUTATIONS.

Gene Mutations.

A B C D Reference Standard (HD728)

Forensic DNA Analysis Protein Synthesis.

Types of Mutations.

DNA and mutations SC.912.L.16.4.

Gene – Expression – Mutation - polymorphism

Small Cell Lung Cancer Exhibits Frequent Inactivating Mutations in the Histone Methyltransferase KMT2D/MLL2: CALGB (Alliance) Arnaud Augert, PhD,

Supplemental Figures Supplemental Figure 1.

X-Linked Intellectual Disability (XLID, XLMR)

Leukemogenic Activity of Cohesin Rings True

Assessment of Capture and Amplicon-Based Approaches for the Development of a Targeted Next-Generation Sequencing Pipeline to Personalize Lymphoma Management

Entry Task Apply: Suppose a template strand of DNA had the following sequence: DNA: T A C G G A T A A C T A C C G G G T A T T C A A What would.

Entry Task Apply: Suppose a template strand of DNA had the following wild-type gene sequence: DNA: T A C G G A T A A C T A C C G G G T A T T C.

Do Now What is the central dogma of biology?

Supplemental Figure 1 A B C

Lesson 1: Evolution.

A: OAZ1 mRNA transcript of 775-1, and parental cell lines showing the stop codon introduced by the nonsense mutations in the and transcripts,

Mutations Any change in an organism’s DNA. Mutations in somatic cells only impact individual; mutations in gametes may impact offspring. 2 Types: A. Gene.

Classification of Introns: U2-Type or U12-Type

Germline BHD-Mutation Spectrum and Phenotype Analysis of a Large Cohort of Families with Birt-Hogg-Dubé Syndrome Laura S. Schmidt, Michael L. Nickerson,

Markus Rechsteiner, Adriana von Teichman, Jan H

Inherited DNA-Repair Defects in Colorectal Cancer

Figure 1 Somatic and germ-line TP53 mutations in cancer

Supplemental Figure 1 – Age Distribution in the CAC Consortium

Mutation: Some Definitions

Schematic depiction of the effect of different types of Duchenne muscular dystrophy (DMD)-causing mutations on the dystrophin transcript. Schematic depiction.

Supplementary Figure 1 A B C CD56 D E F CD56.

Ataxia with Isolated Vitamin E Deficiency: Heterogeneity of Mutations and Phenotypic Variability in a Large Number of Families Laurent Cavalier, Karim.

Mutational analysis of androgen receptor gene in four Chinese patients with male pseudohermaphroditism Xueyan Wu, M.D., Qi Zhou, M.Sc., Jiangfeng Mao,

Mutation Notes.

Methods applied in addition

Mutations The fat cat sad.

Section 20.4 Mutations and Genetic Variation

Mutation Analysis of the Entire PKD1 Gene: Genetic and Diagnostic Implications Sandro Rossetti, Lana Strmecki, Vicki Gamble, Sarah Burton, Vicky Sneddon,

Unit 1 Human Cells Higher Human Biology for CfE Miss Aitken

Multi-Gene Panel Testing of 23,179 Individuals for Hereditary Cancer Risk Identifies Pathogenic Variant Carriers Missed by Current Genetic Testing Guidelines

MYD88 L265P + CCND3 I290R + QC2-03 QC2-05 QC2-11 QC2-12 QC2-13 QC2-19

A: Spectrum of 136 somatic HNF1A mutations observed in 75 HCA samples (top) and in 364 MODY3 individuals (bottom) (data from Ellard and Colclough [25]).

Supplemental Figure 1 Tumor samples Normal samples Chromosome.

Luisa Cimmino, Omar Abdel-Wahab, Ross L. Levine, Iannis Aifantis

Inherited DNA-Repair Defects in Colorectal Cancer

Nonsense-Associated Altered Splicing

Gene Mutations.

The long tail of mutational hotspots in cancer.

Global mutational landscape of the 170 lung adenocarcinoma patients (discovery cohort). Global mutational landscape of the 170 lung adenocarcinoma patients.

Presentation transcript:

Supplemental Figure 1 1 mutation 2 mutations 3 mutations 4 mutations Frequency of cases with respective numbers of TP53 mutations per case[%]

Numbers of TP53 hotspot mutations in each cohort Supplemental Figure 2 A 100 nonsense splice-site in-frame frameshift missense 90 80 70 60 Frequency of TP53 mutation type in relation to the numbers of TP53 mutations in each cohort [%] 50 40 30 20 10 AML ALL CLL MDS B 30 R282 R273 R249 R248 G245 R175 25 20 Numbers of TP53 hotspot mutations in each cohort 15 10 5 AML ALL CLL MDS

Frequency of cases with respective TP53 mutation load [%] Supplemental Figure 3 100 91-100% 81-90% 71-80% 61-70% 51-60% 41-50% 31-40% 21-30% 11-20% 1-10% 90 80 70 60 Frequency of cases with respective TP53 mutation load [%] 50 40 30 20 10 AML ALL CLL MDS