Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Slides:



Advertisements
Similar presentations
Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.
Advertisements

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.
PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.
Etheridge_Fig. S1 NTD * * (368) (154) (296) (131) (146) (477) (271) (391) (141) (248) CTDCTD (570) (363) (483) (232) (340) (675) (446) (588) (318) (422)
Supplemental Figure 1 GhCWIN1 (1) Atßfruct2 (1) Lin6 (1) NtCWIN1 (1) OsCWIN1 (1) ZmCWIN1 (1) Atßfruct4 (1) GhVIN1 (1) GhCWIN1 (45) Atßfruct2 (45) Lin6.
gDNA Atg1-F Atg2-F MW Supplemental Figure S1   Supplemental Figure S1. Agarose gel electrophoresis of the PCR products generated.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
Figure 1 Myotubularin exhibits a tyrosine phosphatase activity
Supplemental Fig. S1 A B AtMYBS aa AtMYBS
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins
Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.
Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.
Figure A. Molecular phylogenetic tree of β-catenin and related proteins. The human E-cadherin and α-catenin were used for root tree. Phylogenetic analyses.
A Unique Type I Keratin Intermediate Filament Gene Family is Abundantly Expressed in the Inner Root Sheaths of Sheep and Human Hair Follicles  C. Simon.
by Takashi Kasukabe, Junko Okabe-Kado, and Yoshio Honma
Rhox: A New Homeobox Gene Cluster
Sequence and comparison of the SDS protein.
by Wen-feng Xu, Zhi-wei Xie, Dominic W. Chung, and Earl W. Davie
Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.
(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.
IgA and IgM VH repertoires in human colon: Evidence for clonally expanded B cells that are widely disseminated  Wolfgang Holtmeier, Andreas Hennemann,
Volume 61, Issue 5, Pages (May 2002)
Volume 19, Issue 6, Pages (December 1997)
A Unique Type I Keratin Intermediate Filament Gene Family is Abundantly Expressed in the Inner Root Sheaths of Sheep and Human Hair Follicles  C. Simon.
Identification of cDNA Encoding a Serine Protease Homologous to Human Complement C1r Precursor from Grafted Mouse Skin  Sung June Byun, Young Yil Bahk,
A Novel Gene Causing a Mendelian Audiogenic Mouse Epilepsy
A Novel Mouse Gene, Sh3yl1, is Expressed in the Anagen Hair Follicle
Volume 64, Issue 4, Pages (October 2003)
Size Polymorphisms in the Human Ultrahigh Sulfur Hair Keratin-Associated Protein 4, KAP4, Gene Family  Naoyuki Kariya, Yutaka Shimomura, Masaaki Ito 
Volume 119, Issue 6, Pages (December 2000)
A Novel Family of Candidate Pheromone Receptors in Mammals
Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China  J. Sun, M. Zhou, Q. Wu, Y.
Volume 10, Issue 8, Pages (April 2000)
Volume 57, Issue 6, Pages (June 2000)
Where would you draw the polyA tail in the gene above?______________
Volume 11, Issue 1, Pages (January 2018)
Volume 11, Issue 19, Pages (October 2001)
Volume 11, Issue 1, Pages (January 2018)
Qiong A. Liu, Michael O. Hengartner  Current Biology 
Bufavirus genotype 3 in Turkish children with severe diarrhoea
Yuji Yamanashi, David Baltimore  Cell 
Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L
Gα-Mediated Inhibition of Developmental Signal Response
Sol i 1, the phospholipase allergen of imported fire ant venom
insomniac and Cullin-3 Regulate Sleep and Wakefulness in Drosophila
The abcc6a Gene Expression Is Required for Normal Zebrafish Development  Qiaoli Li, Sara Sadowski, Michael Frank, Chunli Chai, Andras Váradi, Shiu-Ying.
Rhox: A New Homeobox Gene Cluster
Cell Signalling: Receptor orphans find a family
Characterization of New Members of the Human Type II Keratin Gene Family and a General Evaluation of the Keratin Gene Domain on Chromosome 12q13.13  Michael.
Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development  K. Kosaki,
Molecular Cloning and Tissue Expression of the Murine Analog to Human Stratum Corneum Chymotryptic Enzyme  Assar Bäckman, Lennart Hansson  Journal of.
Identification of the GCS1 ortholog in Gonium pectorale.
Stella Plakidou-Dymock, David Dymock, Richard Hooley  Current Biology 
Natural Variation in Tomato Reveals Differences in the Recognition of AvrPto and AvrPtoB Effectors from Pseudomonas syringae  Christine M. Kraus, Kathy R.
The family of bone morphogenetic proteins
Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.
Amino acid sequence deduced from the sequence of contig 131 of G
Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.
Cloning, sequencing, and recombinant production of Sin a 2, an allergenic 11S globulin from yellow mustard seeds  Oscar Palomares, PhD, Andrea Vereda,
Phylogenetic analysis of AquK2P.
Volume 14, Issue 9, Pages (May 2004)
M L L L V L L V V L I L L I V R R Predicted transmembrane domain
New microsome-associated HT-family proteins from Nicotiana respond to pollination and define an HT/NOD-24 protein family  Kondo Katsuhiko , McClure Bruce.
Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.
Mutations in the Human Orthologue of the Mouse underwhite Gene (uw) Underlie a New Form of Oculocutaneous Albinism, OCA4  J.M. Newton, Orit Cohen-Barak,
Volume 97, Issue 6, Pages (June 1999)
Volume 15, Issue 17, Pages (September 2005)
Volume 53, Issue 4, Pages (October 2010)
Volume 1, Issue 5, Pages (September 2008)
Presentation transcript:

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers that were used in the study are indicated with arrow. The conserved flanking active aspartate is shaded. Cysteine residues are boxed. The polyadenylation signal (AATAAA) is indicated single underline.

Figure 2: Multiple alignment of amino acid sequences of the O Figure 2: Multiple alignment of amino acid sequences of the O. fasciatus Lysozyme C and other Lysozyme C. Identical (*) and similar (.) amino acid residues are indicated. Gaps (−) were introduced to maximize the alignment. The conserved flanking active aspartate region is shaded green. The two essential catalytic residuce are shown as arrow. The positions of cysteine residues identical in all sequences are shaded blue.

Figure 3: Neighbor-joining phylogenetic tree of Lysozyme C amino acid sequences reported in representative taxa. The bootstrap confidence values shown at the nodes of the tree are based on 2000 bootstrap replications.

Figure 4: Expression of RbLysC cDNAs in various tissues of healthy Rock bream as determined by Real-time PCR. PBLs, head kidney, trunk kidney, spleen, liver, intestine, gill, and muscle were examined. The asterisk indicates a statistically significant difference (P < 0.05).