Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China  J. Sun, M. Zhou, Q. Wu, Y.

Slides:



Advertisements
Similar presentations
Models for the organisation of hospital infection control and prevention programmes B. Gordts Clinical Microbiology and Infection Volume 11, Pages
Advertisements

The first report of detecting the blaSIM-2 gene and determining the complete sequence of the SIM-encoding plasmid  F. Sun, D. Zhou, Q. Wang, J. Feng,
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
L.H. Su, T.L. Wu, C.H. Chiu  Clinical Microbiology and Infection 
C.-S. Lee, J.-H. Lee  Clinical Microbiology and Infection 
Validation of a four-primer real-time PCR as a diagnostic tool for single and mixed Plasmodium infections  L. Cnops, J. Jacobs, M. Van Esbroeck  Clinical.
R. Dumke, H. von Baum, P.C. Lück, E. Jacobs 
L. Boyanova  Clinical Microbiology and Infection 
High prevalence of azithromycin resistance to Treponema pallidum in geographically different areas in China  X.-S. Chen, Y.-P. Yin, W.-H. Wei, H.-C. Wang,
The greatest steps towards the discovery of Vibrio cholerae
Characterisation of OXA-51, a novel class D carbapenemase found in genetically unrelated clinical strains of Acinetobacter baumannii from Argentina  S.
Prediction of virological response by pretreatment hepatitis B virus reverse transcriptase quasispecies heterogeneity: the advantage of using next-generation.
L.H. Su, T.L. Wu, C.H. Chiu  Clinical Microbiology and Infection 
Characterisation of fluoroquinolone-resistant clinical isolates of Streptococcus pyogenes in Barcelona, Spain  A. Rivera, M. Rebollo, F. Sánchez, F. Navarro,
Nosocomial infection caused by class 1 integron-carrying Staphylococcus aureus in a hospital in South China  Z. Xu, L. Shi, C. Zhang, L. Zhang, X. Li,
Genomics of epidemic pathogens
C.-S. Lee, J.-H. Lee  Clinical Microbiology and Infection 
A.K. Reddy, P. Garg, I. Kaur  Clinical Microbiology and Infection 
O. Barraud, M. Casellas, C. Dagot, M.-C. Ploy 
Genetic detection of Dobrava/Belgrade virus in a Czech patient with Haemorrhagic fever with renal syndrome  A. Papa, H. Zelená, D. Barnetová, L. Petroušová 
B.J. Kocjan, D. Bzhalava, O. Forslund, J. Dillner, M. Poljak 
R. Cantón  Clinical Microbiology and Infection 
A novel VIM‐type metallo‐beta‐lactamase (VIM‐14) in a Pseudomonas aeruginosa clinical isolate from a neonatal intensive care unit  A. Mazzariol, C. Mammina,
B.J. Kocjan, D. Bzhalava, O. Forslund, J. Dillner, M. Poljak 
Evaluation of differential gene expression in susceptible and resistant clinical isolates of Klebsiella pneumoniae by DNA microarray analysis  A. Doménech-Sánchez,
Genetic association of blaSHV-5 with transposable elements IS26 and IS5 in Klebsiella pneumoniae from Taiwan  W.L. Yu, S.C. Chen, S.W. Hung, Y.C. Chuang,
High prevalence of ST-78 infection-associated vancomycin-resistant Enterococcus faecium from hospitals in Asunción, Paraguay  M.A. Khan, J.B. Northwood,
Nosocomial infection caused by class 1 integron-carrying Staphylococcus aureus in a hospital in South China  Z. Xu, L. Shi, C. Zhang, L. Zhang, X. Li,
Vector control: a cornerstone in the malaria elimination campaign
Molecular mechanism of gentamicin resistance in Bartonella henselae
Novel and uncommon antimicrobial resistance genes in livestock-associated methicillin- resistant Staphylococcus aureus  K. Kadlec, A.T. Feßler, T. Hauschild,
The first report of detecting the blaSIM-2 gene and determining the complete sequence of the SIM-encoding plasmid  F. Sun, D. Zhou, Q. Wang, J. Feng,
Emerging carbapenemases in Gram-negative aerobes
A. Papa, K. Dumaidi, F. Franzidou, A. Antoniadis 
Training for the infectious diseases speciality in Norway
L.-T. Wu, S.-W. Hung, Y.-C. Chuang, H.-E. Chen, R.N. Jones, W.-L. Yu 
Dissemination of multidrug-resistant, class 1 integron-carrying Acinetobacter baumannii isolates in Taiwan  L.-Y. Huang, T.-L. Chen, P.-L. Lu, C.-A. Tsai,
Prevalence of the sat, set and sen genes among diverse serotypes of Shigella flexneri strains isolated from patients with acute diarrhoea  S.K. Niyogi,
Integrons and gene cassettes in clinical isolates of co-trimoxazole-resistant Gram- negative bacteria  M. Grape, A. Farra, G. Kronvall, L. Sundström  Clinical.
CMI editorial report 2011 Clinical Microbiology and Infection
Antibiotic resistance patterns of Escherichia coli isolates from different aquatic environmental sources in Leon, Nicaragua  E. Amaya, D. Reyes, M. Paniagua,
S. A. Gomez, F. G. Pasteran, D. Faccone, N. Tijet, M. Rapoport, C
Prevalence of Streptococcus pneumoniae isolates bearing macrolide resistance genes in association with integrase genes of conjugative transposons in Japan 
A novel phlebovirus in Albanian sandflies
Evidence of horizontal gene transfer between amoeba and bacteria
C. Héritier, L. Poirel, P. Nordmann 
Metagenomics and probiotics
Laboratory diagnosis of Clostridium difficile disease
Identification of a novel cosavirus species in faeces of children and its relationship with acute gastroenteritis in China  J.-M. Yu, Y.-Y. Ao, L.-L.
T.M. File  Clinical Microbiology and Infection 
A. McNally, F. Alhashash, M. Collins, A. Alqasim, K. Paszckiewicz, V
Twelve years of fluconazole in clinical practice: global trends in species distribution and fluconazole susceptibility of bloodstream isolates of Candida 
A.P. Underwood, J. Green  Clinical Microbiology and Infection 
Rebecca J. Seward, Kevin J. Towner  Clinical Microbiology and Infection 
Association of the blaCMY-10 gene with a novel complex class 1 integron carrying an ISCR1 element in clinical isolates from Korea  J.S. Song, S.J. Jang,
Human infection with novel G3P[25] rotavirus strain in Taiwan
Evaluation of hybridisation on oligonucleotide microarrays for analysis of drug-resistant Mycobacterium tuberculosis  D. Gryadunov, V. Mikhailovich, S.
U. Garza-Ramos, G. Davila, V. Gonzalez, C. Alpuche-Aranda, V. R
Resistance integrons and super-integrons
K. S. Ko, T. Kuwahara, L. Haehwa, Y. -J. Yoon, B. -J. Kim, K. -H
M. Biçmen, Z. Gülay, S.V. Ramaswamy, D.M. Musher, D. Gür 
J.L. Balcázar  Clinical Microbiology and Infection 
G.C. Schito  Clinical Microbiology and Infection 
Sandfly fever virus outbreak in Cyprus
Typing of Clostridium difficile
Microarray-based characterisation of a Panton–Valentine leukocidin-positive community- acquired strain of methicillin-resistant Staphylococcus aureus 
Impact of antibiotic restrictions: the patient's perspective
L. Poirel, T. Vu Nguyen, A. Weintraub, C. Leviandier, P. Nordmann 
The future of diagnostic bacteriology
The origin of a methicillin-resistant Staphylococcus aureus isolate at a neonatal ward in Sweden—possible horizontal transfer of a staphylococcal cassette.
Presentation transcript:

Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China  J. Sun, M. Zhou, Q. Wu, Y. Ni  Clinical Microbiology and Infection  Volume 16, Issue 8, Pages 1125-1129 (August 2010) DOI: 10.1111/j.1469-0691.2009.03060.x Copyright © 2010 European Society of Clinical Infectious Diseases Terms and Conditions

FIG. 1 Nucleotide sequence of a 2782-bp PCR amplicon of the class 1 integron on pMD354A showing the arr-3, dfrA27 and aadA16 gene cassettes and parts of the 5′-conserved and 3′-conserved segments of the integron. The deduced amino acid sequences of the novel dfrA27 and aadA16 genes are shown below the nucleotide sequence. The start codons of the open reading frames are indicated by horizontal arrows, and the stop codons are indicated by asterisks. The –35 and –10 promoter regions are underlined. The core sites and inverse core sites are boxed. The 102-bp putative promoter-bearing sequences are in bold. The primers are indicated by grey boxes. Clinical Microbiology and Infection 2010 16, 1125-1129DOI: (10.1111/j.1469-0691.2009.03060.x) Copyright © 2010 European Society of Clinical Infectious Diseases Terms and Conditions

FIG. 2 Alignment and boundary structure of the 102-bp promoter-bearing sequences upstream from some aminoglycoside resistance genes and the qacEΔ1 gene. The putative core sites are boxed. The palindrome is indicated by grey boxes. The genes following the promoter sequence are indicated by arrows. Clinical Microbiology and Infection 2010 16, 1125-1129DOI: (10.1111/j.1469-0691.2009.03060.x) Copyright © 2010 European Society of Clinical Infectious Diseases Terms and Conditions