Genetic events disrupting perA.

Slides:

Advertisements

Similar presentations

Mutations Section 12–4 This section describes and compares gene mutations and chromosomal mutations.

Advertisements

Genetic Mutations. Mutations What is a genetic mutation? A change in the genetic code Genetic mutations may have no effect, a beneficial effect, or a.

Mutations Chapter 12.4.

the Genetic Code Shown as mRNA 5′ → 3′ 64 codons Redundant

Mutations in DNA changes in the DNA sequence that can be inherited can have negative effects (a faulty gene for a trans- membrane protein leads to cystic.

8.7 Mutations A mutation is a change in an organism’s DNA. This may or may not affect phenotype.

Slide 1 of 24 VIII MUTATIONS Mutations Types of Mutations:

Mutation. What you need to know How alteration of chromosome number or structurally altered chromosomes can cause genetic disorders How point mutations.

8.7 Mutations A mutation is a change in an organism’s DNA. May occur during replication. May affect a single gene, or an entire chromosome May or may not.

A change in the nucleotide sequence of DNA Ultimate source of genetic diversity Gene vs. Chromosome.

Jeopardy 20 Squares Start Rules:

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

22 kDa a-coixin gene cluster

“How does it affect the protein?”

Gene Mutations.

Mutations Chapter 12-4.

Types of Mutations.

Gene Mutations.

Mark M Metzstein, H.Robert Horvitz Molecular Cell

Volume 8, Issue 2, Pages (August 2001)

Sequence analysis of near full-size proviruses.

Entry Task Apply: Suppose a template strand of DNA had the following wild-type gene sequence: DNA: T A C G G A T A A C T A C C G G G T A T T C.

Analysis of perA integrity within nonhybrid Epichloë species.

Mutations (Section 17-5) Now, that you know how gene expression works, let’s see how changes in the gene affect how the protein is made.

Some mutations affect a single gene, while others affect an entire chromosome.

A: OAZ1 mRNA transcript of 775-1, and parental cell lines showing the stop codon introduced by the nonsense mutations in the and transcripts,

Group A1 Caroline Kissel, Meg Sabourin, Kaylee Isaacs, Alex Maeder

Syndromic Short Stature in Patients with a Germline Mutation in the LIM Homeobox LHX4 Kalotina Machinis, Jacques Pantel, Irène Netchine, Juliane Léger,

A mutation is a change in an organism’s DNA.

Schematic representation of the lbk gene, positions of gRNAs, and knock-in cassette. Schematic representation of the lbk gene, positions of gRNAs, and.

Volume 117, Issue 3, Pages (September 1999)

Fig. 1. Mutations in slpA confer Av-CD291.2 resistance.

GT repeats are unique to Cdk6 and are conserved in different mammals.

Phylogenetic tree of perA A2-domain DNA sequence.

Fig. 2 Identification of the candidate AvrSr35 gene.

Analysis of perA integrity from infected plant material.

Expression of a microRNA-Resistant Target Transgene Misrepresents the Functional Significance of the Endogenous microRNA: Target Gene Relationship Junyan.

Schematic depiction of the effect of different types of Duchenne muscular dystrophy (DMD)-causing mutations on the dystrophin transcript. Schematic depiction.

A Novel Point Mutation Affecting the Tyrosine Kinase Domain of the TRKA Gene in a Family with Congenital Insensitivity to Pain with Anhidrosis Shinichi.

Ataxia with Isolated Vitamin E Deficiency: Heterogeneity of Mutations and Phenotypic Variability in a Large Number of Families Laurent Cavalier, Karim.

A Mutation in the Variable Repeat Region of the Aggrecan Gene (AGC1) Causes a Form of Spondyloepiphyseal Dysplasia Associated with Severe, Premature.

sac mutants are hypersensitive to IR

Complete Haplotype Sequence of the Human Immunoglobulin Heavy-Chain Variable, Diversity, and Joining Genes and Characterization of Allelic and Copy-Number.

Mutation Notes.

Targeted Genome Editing in Genes and cis-Regulatory Regions Improves Qualitative and Quantitative Traits in Crops Xitao Li, Yongyao Xie, Qinlong Zhu,

Opitz G/BBB Syndrome in Xp22: Mutations in the MID1 Gene Cluster in the Carboxy- Terminal Domain Karin Gaudenz, Erich Roessler, Nandita Quaderi, Brunella.

Schematic drawing of alternatively-spliced GFP reporter gene.

Copyright Pearson Prentice Hall

Evolutionary History of the ADRB2 Gene in Humans

Mutations The fat cat sad.

iraL shares sequence identity with iraM from E

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Generation of heterozygous mutations with the CRISPR-Cas9 system.

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

The C2H2 zinc-finger factor ztf-16 is required for ver-1 expression.

Volume 21, Issue 23, Pages (December 2011)

Structure of the IFL1 Gene and the Nature of the Mutations in the ifl1 Alleles.(A) A schematic representation of the exon and intron organization of the.

Mutation of the Ca2+ Channel β Subunit Gene Cchb4 Is Associated with Ataxia and Seizures in the Lethargic (lh) Mouse Daniel L Burgess, Julie M Jones,

Matthew A. Saunders, Jeffrey M. Good, Elizabeth C. Lawrence, Robert E

Danna K Morris, Victoria Lundblad Current Biology

Volume 9, Issue 16, Pages S1-868 (August 1999)

Molecular Characterization of the brd2 Mutation

BRCA1 protein functional domains and predicted frameshift and premature truncation. BRCA1 protein functional domains and predicted frameshift and premature.

Presentation transcript:

Genetic events disrupting perA. Genetic events disrupting perA. Gene maps of sequenced perA annotated with mutations likely to cause loss of function. (A) Gene maps of full-length perA sequences. The PerA domains shown on the functional perA gene map are listed in Fig. 2. The 13 Per+perA alleles represented by the first gene map are from E. amarillans E57 and E4668, E. baconii E1031, E. brachyelytri E4804, E. bromicola AL0434, E501, and E502, E. elymi E56, E. festucae Fl1, E. typhina E8, E. typhina subsp. poae BlaTG-1 isolate NFe671 (incomplete allele sequence), Epichloë sp. FaTG-2 G2 isolate NFe45079, and Epichloë sp. FaTG-3 isolate NFe1100. Gene maps of perA per− alleles detail causative mutations of full-length perA null alleles. (B) Partial gene maps of perA null alleles. (C) Gene maps of perA-ΔR* alleles. The 9 alleles represented by the initial gene map originate from E. baconii As6 and E424, E. festucae E189 and E2368 (identical alleles), E. siegelii e915 allele 1, E. typhina E1022 and OR10 (incomplete allele sequence), E. typhina subsp. poae E5819, and Epichloë sp. e4768 (incomplete allele sequence). Gene maps of other perA-ΔR* alleles detail changes that result in frameshift, nonsense, or large deletion mutations upstream of the conserved perA-ΔR* deletion site. Hollow arrows indicate the coding sequence for each allele, with the arrow ending at the first stop codon. Gene maps are annotated as follows. Frameshift-causing insertions or deletions are shown as white or black circles, respectively, with the number indicating how many nucleotides were inserted or deleted. SNPs that generate nonsense-mutation are shown as black hexagons. SNPs that disrupt the ATG start codon are shown as white squares. Large sequence deletions are shown as dashed lines, with the deletion shown relative to perA from E. festucae Fl1, and solid lines indicate conserved sequence located downstream of a premature stop codon. Eam, E. amarillans; Ebm, E. bromicola; Efe, E. festucae; Ety, E. typhina; Etp, E. typhina subsp. poae; LAE, Lolium-associated endophyte. Daniel Berry et al. Appl. Environ. Microbiol. 2015;81:2797-2807