STAT Genes Found in C. elegans

Slides:

Advertisements

Similar presentations

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Advertisements

Volume 7, Issue 6, Pages (December 1997)

Mark M Metzstein, H.Robert Horvitz Molecular Cell

Fig. 1. NS1 protein alignment and linear epitope mapping of the 10 antibodies used to run the DENV serotype–specific NS1 rapid tests, pan-DENV NS1 test,

There are four levels of structure in proteins

Dun1 Counts on Rad53 to Be Turned On

Ross Alexander Robinson, Xin Lu, Edith Yvonne Jones, Christian Siebold

Sequence and comparison of the SDS protein.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

Multiple sequence alignment and analysis of SOFL proteins.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Prediction of protein structure

Phosphopeptides identified harboring minimal binding motifs

Debanu Das, Millie M Georgiadis Structure

Volume 43, Issue 2, Pages (July 2004)

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Structure of the 5′ Portion of the Human Plakoglobin Gene

Figure 1 CD36 structure and post-translational modifications

The C. elegans SYS-1 Protein Is a Bona Fide β-Catenin

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Ross Alexander Robinson, Xin Lu, Edith Yvonne Jones, Christian Siebold

Qiong A. Liu, Michael O. Hengartner Current Biology

Yuji Yamanashi, David Baltimore Cell

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Prediction of Plant MicroRNA Targets

Fig. 1 A single amino acid difference in the ATP-binding domain of GSK3α and GSK3β results in structural and topological differences. A single amino acid.

Tauomics and Kinetics in Human Neurons and Biological Fluids

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Volume 13, Issue 2, Pages R50-R52 (January 2003)

Crystal Structure of a Phosphoinositide Phosphatase, MTMR2

Cell Signalling: Receptor orphans find a family

Congratulations! Now Get to Work

by Jacob O. Brunkard, Anne M. Runkel, and Patricia C. Zambryski

The ced-8 Gene Controls the Timing of Programmed Cell Deaths in C

Mohammad Azam, Robert R. Latek, George Q. Daley Cell

Cloning of a novel gene in the human kidney homologous to rat munc13s: Its potential role in diabetic nephropathy Yong Song, Menachem Ailenberg, Mel.

Volume 85, Issue 6, Pages (June 1996)

Identification of the GCS1 ortholog in Gonium pectorale.

Hartmut Scheel, Kay Hofmann Current Biology

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Structure prediction: Folding proteins by pattern recognition

Figure 1 Pedigree and genetic findings

Structure of STAT6CF and N4 site DNA complex.

Crystal structure of STAT6CF-N3 complex and its comparison with STAT6CF-N4 complex structure. Crystal structure of STAT6CF-N3 complex and its comparison.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Distribution of phosphosites and PDGFRα activity in primary cultures.

Volume 2, Issue 1, Pages 1-4 (January 1994)

PfSec13 is a structural homolog of ScSec13·Nup145C.

Amino acid sequence deduced from the sequence of contig 131 of G

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Fig. 4. The predicted protein domains in sma

SUR-8, a Conserved Ras-Binding Protein with Leucine-Rich Repeats, Positively Regulates Ras-Mediated Signaling in C. elegans Derek S Sieburth, Qun Sun,

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Kristine K. Kikly, PhDa, Bruce S. Bochner, MDg, Sylvie D

Phosphopeptides identified harboring minimal binding motifs

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Alignment of the deduced amino acid sequence of rat olfactory CNCβ1b with bovine rod CNCβ1a. Alignment of the deduced amino acid sequence of rat olfactory.

Selectivity-determining regions

Cecilia P. Sanchez, Paul Horrocks, Michael Lanzer Cell

Bacteriophage DNA Packaging

Volume 7, Issue 1, Pages 1-11 (July 1997)

Adam T. McGeoch, Stephen D. Bell Cell

Primary structure of zebra finch CREB

Xiaowu Gai, Daniel F. Voytas Molecular Cell

Debanu Das, Millie M Georgiadis Structure

The Tail That Wags the Dog: How the Disordered C-Terminal Domain Controls the Transcriptional Activities of the p53 Tumor-Suppressor Protein Oleg Laptenko,

Volume 95, Issue 2, Pages (October 1998)

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

STAT Genes Found in C. elegans by Xiangdong Liu, Anne Marie Quinn, Yue E. Chin, and Xin-Yuan Fu Science Volume 285(5425):167-167 July 9, 1999 Published by AAAS

Figure 1 Coiled-coil domains (A), DNA-binding domains (B), SH2 domains (C), and potential tyrosine phosphorylation sites (D) of human Stat5b, CE-STAT-A, and CE-STAT-B were aligned using MegAlign from the LaserGene program (http://www.dnastar.com). Coiled-coil domains (A), DNA-binding domains (B), SH2 domains (C), and potential tyrosine phosphorylation sites (D) of human Stat5b, CE-STAT-A, and CE-STAT-B were aligned using MegAlign from the LaserGene program (http://www.dnastar.com). Relative starting and ending positions of the four functional domains were selected in reference to those in human Stat1, which are defined by crystal structure (6). CE-STAT-B does not contain a coiled coil domain predicted with high probability. Amino acids that are identical in at least two sequences were shaded and functionally conserved residues between all STATs were boxed. Xiangdong Liu et al. Science 1999;285:167 Published by AAAS