Comparison of amino acid regions forming [4Fe-4S] clusters in the SplB amino acid sequences from Bacillus anthracis (B.an), B. amyloliquefaciens (B.am),

Slides:

Advertisements

Similar presentations

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Advertisements

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Deoxyribonucleotide production

تأثير درجة الحرارة على الكائنات الحية الدقيقة

Sequence and comparison of the SDS protein.

Phosphopeptides identified harboring minimal binding motifs

Volume 11, Issue 12, Pages (December 2003)

Glycerol Dehydrogenase

Increase in biologically effective UV irradiance (biologically effective dose) with decreasing simulated ozone column thickness as measured by the spore.

Frequency of inactivated spores of B

Shielding of bacterial spores against galactic cosmic radiation by meteorite material. Shielding of bacterial spores against galactic cosmic radiation.

Three-dimensional structure of B. subtilis PRPP synthase.

Allosteric site of B. subtilis PRPP synthase.

Cross-section of a spore of B. subtilis.

Biochemical function of PRPP

Solar spectrum in space (thin line) and on Earth's surface (thick line). Solar spectrum in space (thin line) and on Earth's surface (thick line). Below.

Phrap assemblies visualized with the Consed (53) program.

Catalytic strategies. Catalytic strategies. The coordination of Mg2+ (shown as blue spheres) of the active site to the substrates, to amino acid residues,

Possible secondary structure of the S. enterica prs leader.

Biostack experiment, a method to study the biological effects of single heavy ions of cosmic radiation. Biostack experiment, a method to study the biological.

Catalytic mechanism of PRPP synthase.

Volume 12, Issue 8, Pages (August 2004)

Alignments of the complete genome sequences of the B

The first step in sugar transport: crystal structure of the amino terminal domain of enzyme I of the E. coli PEP: sugar phosphotransferase system and.

Identification of the GCS1 ortholog in Gonium pectorale.

Current model for Fe-S cluster assembly by the Suf system.

General strategies of cellulose hydrolysis and utilization by aerobic (top) and anaerobic (bottom) bacteria. General strategies of cellulose hydrolysis.

Alignment of N-terminal sequences of type IV pilin proteins.

Annoted amino acid sequence of Aedes aegypti gliotactin (Gli).

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Summary of major events in Earth history relating to the appearance of eukaryotic groups and the appearance of O2 in the atmosphere and in marine environments.

Phosphopeptides identified harboring minimal binding motifs

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

Structures of P. aeruginosa ExoU and its chaperone, SpcU (PDB ID 3TU3), shown as a cartoon. Structures of P. aeruginosa ExoU and its chaperone, SpcU (PDB.

Electron micrograph of negatively stained protofilaments assembled in vitro from E. coli FtsZ (1 μM FtsZ, 50 mM MES [morpholineethanesulfonic acid] [pH.

Schematic representation of the hydrolysis of amorphous and microcrystalline cellulose by noncomplexed (A) and complexed (B) cellulase systems. Schematic.

UV resistance of spores and vegetative cells of B

Scheme for recovery of viral nucleic acid from microarray spots.

T4P gene clusters in C. perfringens and C. difficile.

Protein structures of various PFT classes.

Extreme resistance of D

Prophage genome map of the C. diphtheriae prophage encoding DT

Molecular models for module exchange between phages.

Building blocks and synthesis reactions of the peptidoglycan.

MEED exposure facility mounted on the camera beam of the lunar orbiter of the Apollo 16 mission (A) and sample cuvette for exposing dry layers of microorganisms.

Structure of an exporter.

Binding of mRNA to the 30S ribosomal subunit.

Phylogenetic positions of the Fe hydrogenases of termite gut symbionts

Incorporation of new cell wall in differently shaped bacteria.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

General scheme of the events triggered by C

Conserved motifs in the ABC

Absorption spectra of PRs in relation to light attenuation patterns in different marine environments. Absorption spectra of PRs in relation to light attenuation.

The selective advantage (relative fitness) of a mutant genome (with its associated cloud) alters the rate of dominance in a population. The selective advantage.

Thermodynamic cycle for ligand binding to a periplasmic-BP.

Intrastrand biases (nucleotide skew) in the T4 genome.

Structures of T4 pilins and minor pilins.

General overview of the bioinformatic pipelines for the 16S rRNA gene microbial profiling and shotgun metagenomics. General overview of the bioinformatic.

Mono-ADP-ribosylation cycle and the corresponding products of protein mono-ADP-ribosylation. Mono-ADP-ribosylation cycle and the corresponding products.

Alignment of PilT retraction ATPases.

Repair kinetics of radiation-induced DNA damage under microgravity conditions. Repair kinetics of radiation-induced DNA damage under microgravity conditions.

IF2 and structural homologues.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

TolA, TolB, and Pal crystal structures.

Acquisition of global regulators during the evolution of streptomycetes. Acquisition of global regulators during the evolution of streptomycetes. The multilocus.

DDE consensus of different families.

Molecular model of the Helicobacter pylori PldA1 dimer.

Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein of E. coli. Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein.

Structure of an ATP-bound ABC dimer.

Presentation transcript:

Comparison of amino acid regions forming [4Fe-4S] clusters in the SplB amino acid sequences from Bacillus anthracis (B.an), B. amyloliquefaciens (B.am), B. stearothermophilus (B.st), B. subtilis (B.su),Clostridium acetobutylicum (C.ac), and C. difficile (C.di) with the [4Fe-4S] clusters of: the activating subunits of ribonucleotide reductase (NrdG) and pyruvate-formate lyase (Act) from Escherichia coli (E.co), phage T4 (T4), andHaemophilus influenzae (H.in) and the [4Fe-4S] clusters from lysine-2,3-aminomutase (KamA) from Clostridium subterminale (C.su), biotin synthase (BioB) from B. subtilis, and the probable lipoic acid synthase (YutB) fromB. subtilis. Comparison of amino acid regions forming [4Fe-4S] clusters in the SplB amino acid sequences from Bacillus anthracis (B.an), B. amyloliquefaciens (B.am), B. stearothermophilus (B.st), B. subtilis (B.su),Clostridium acetobutylicum (C.ac), and C. difficile (C.di) with the [4Fe-4S] clusters of: the activating subunits of ribonucleotide reductase (NrdG) and pyruvate-formate lyase (Act) from Escherichia coli (E.co), phage T4 (T4), andHaemophilus influenzae (H.in) and the [4Fe-4S] clusters from lysine-2,3-aminomutase (KamA) from Clostridium subterminale (C.su), biotin synthase (BioB) from B. subtilis, and the probable lipoic acid synthase (YutB) fromB. subtilis. Highly conserved residues are in bold, and invariant cysteines are marked with an asterisk. Wayne L. Nicholson et al. Microbiol. Mol. Biol. Rev. 2000; doi:10.1128/MMBR.64.3.548-572.2000