Author correction: Triple association of CDC25-, Dbl- and Sec7-related domains in mammalian guanine nucleotide exchange factors C. Abergel, P. Chavrier,

Slides:

Advertisements

Similar presentations

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

Advertisements

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

What’s new in GO?. Priorities Annotation outreach Reference genomes User advocacy Ontology development Software.

Bhalchandra Jadhav, Klemens Wild, Martin R. Pool, Irmgard Sinning

Binding of APC‐derived C‐terminal peptides to EB1‐C.

Homozygosity Mapping Reveals Mutations of GRXCR1 as a Cause of Autosomal- Recessive Nonsyndromic Hearing Impairment Margit Schraders, Kwanghyuk Lee, Jaap.

Volume 11, Issue 3, Pages (March 2003)

Volume 13, Issue 1, Pages (January 2005)

Evolution of Biochemical Pathways

Gammaherpesvirus infection modulates the temporal and spatial expression of SCGB1A1(CCSP) and BPIFA1 (SPLUNC1) in the respiratory tract Gail H. Leeming,

Volume 141, Issue 6, Pages (June 2010)

The Y-Family of DNA Polymerases

Every living organism inherits a blueprint for life from its parents.

Volume 13, Issue 1, Pages (January 2005)

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Variable neurologic phenotype in a GEFS+ family with a novel mutation in SCN1A Krista Mahoney, Susan J. Moore, David Buckley, Muhammed Alam, Patrick Parfrey,

Mutation Altering the miR-184 Seed Region Causes Familial Keratoconus with Cataract Anne E. Hughes, Declan T. Bradley, Malcolm Campbell, Judith Lechner,

Volume 11, Issue 4, Pages (April 2003)

TGFβ Signaling: Receptors, Transducers, and Mad Proteins

High Prevalence of SLC6A8 Deficiency in X-Linked Mental Retardation

Argonaute proteins Current Biology

Crystal Structure of a Human Cleavage Factor CFIm25/CFIm68/RNA Complex Provides an Insight into Poly(A) Site Recognition and RNA Looping Qin Yang, Molly.

by , Christine G. Elsik, Ross L. Tellam, and Kim C. Worley

Crystal Structure of an Ephrin Ectodomain

Volume 11, Issue 1, Pages (January 2001)

Volume 23, Issue 6, Pages (December 2012)

Allelic Heterogeneity in the COH1 Gene Explains Clinical Variabilityin Cohen Syndrome Hans Christian Hennies, Anita Rauch, Wenke Seifert, Christian Schumi,

Simon Bergqvist, Mark A Williams, Ronan O'Brien, John E Ladbury

Volume 28, Issue 4, Pages (November 2007)

Eph Nomenclature Committee Cell

Volume 15, Issue 2, Pages (February 2007)

Volume 18, Issue 5, Pages (May 2005)

Volume 64, Issue 5, Pages (November 2003)

Identification of novel F-box proteins in Xenopus laevis

Volume 10, Issue 14, Pages R512-R513 (July 2000)

Crystal Structure of an Ephrin Ectodomain

Figure 2 DNA sequence analysis of VPS37A

Volume 23, Issue 3, Pages (August 2006)

Structure, Exchange Determinants, and Family-Wide Rab Specificity of the Tandem Helical Bundle and Vps9 Domains of Rabex-5 Anna Delprato, Eric Merithew,

Volume 24, Issue 3, Pages (March 2016)

Volume 13, Issue 1, Pages (January 2003)

Linking transcriptional mediators via the GACKIX domain super family

The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors Wei Li, Cong Ma, Rong Guan, Yibin Xu,

Volume 111, Issue 1, Pages (October 2002)

Gang Dong, Martina Medkova, Peter Novick, Karin M. Reinisch

Volume 112, Issue 2, Pages (January 2003)

CARPEL FACTORY, a Dicer Homolog, and HEN1, a Novel Protein, Act in microRNA Metabolism in Arabidopsis thaliana Wonkeun Park, Junjie Li, Rentao Song,

The Mouse Mps1p-like Kinase Regulates Centrosome Duplication

L. Aravind, Eugene V. Koonin Current Biology

R119 is highly conserved, and the p

Crystal Structure of Saccharopine Reductase from Magnaporthe grisea, an Enzyme of the α-Aminoadipate Pathway of Lysine Biosynthesis Eva Johansson, James.

L. Aravind, Eugene V. Koonin Current Biology

Bioinformatics analysis of the small TbTim amino acid sequences.

Volume 7, Issue 9, Pages (September 1999)

Volume 20, Issue 1, Pages (January 2012)

Volume 100, Issue 4, Pages (February 2000)

Volume 107, Issue 4, Pages (November 2001)

How to search NCBI.

Missense Mutation in Pseudouridine Synthase 1 (PUS1) Causes Mitochondrial Myopathy and Sideroblastic Anemia (MLASA) Yelena Bykhovskaya, Kari Casas, Emebet.

Computational analysis of the Msi1 3′UTR sequence and identification of the associated RBP activities. Computational analysis of the Msi1 3′UTR sequence.

The sequence alignment of GC1 and GC2 domains from TgATPaseP-GC with other representative cyclases identifies signature residues. The sequence alignment.

L. Aravind, Eugene V. Koonin Current Biology

Volume 14, Issue 3, Pages (March 2006)

Volume 5, Issue 4, Pages (July 2012)

Rtt101 and Mms1 in budding yeast form a CUL4DDB1‐like ubiquitin ligase that promotes replication through damaged DNA Mms1 belongs to the DDB1 family of.

The NB-ARC domain: a novel signalling motif shared by plant resistance gene products and regulators of cell death in animals Erik A. van der Biezen,

L. Aravind, Eugene V. Koonin Current Biology

Comparative Genomic Analysis Identifies an ADP-Ribosylation Factor–like Gene as the Cause of Bardet-Biedl Syndrome (BBS3) Annie P. Chiang, Darryl Nishimura,

Correspondence Current Biology

Angioid Streaks in Pseudoxanthoma Elasticum: Role of the p

Presentation transcript:

Author correction: Triple association of CDC25-, Dbl- and Sec7-related domains in mammalian guanine nucleotide exchange factors C. Abergel, P. Chavrier, J-M. Chaverie Trends in Biochemical Sciences Volume 24, Issue 5, (May 1999) DOI: 10.1016/S0968-0004(99)01402-4

Fig. 1 Clustal W (Ref. 11) alignment of 13 Sec7-related sequences and five CDC25-related sequences. The first eight sequences (ARNO to GEA1) correspond to guanine-nucleotide-exchange factors (GEFs) that act on ADP-ribosylation factors (ARFs) ARF1 and ARF3, whereas the targets of the Sec7p, GNOM and TYL proteins are not known. The five mammalian GEF proteins captured in the search are shown in green. The 11 positions shown in red are strictly conserved (with one exception, RAsGRF2_MM, where a Leu→Pro change is caused by a single T→C nucleotide change in the mRNA sequence). The 13 positions shown in blue are identical in all Sec7-related sequences. Positions corresponding to the consensus (>50% identity) in the Sec7 domain are shown in green. GenBank accession numbers follow (in parentheses): ARNO_HS (X99753); ARNO3_HS (AJ223957); CDC25_HS (L26584); CH-1_HS (M85169); Gea1p_SC (Z49531); GNOM_AT (U36433); GNRP_MM (L20899); GNRP_RN (X67241); GRP1_MM (AF001871); MER2p_SC (Z49531); RAsGRF2_HS (AF023130_1); RAsGRF2_MM (U67326); RIP1p_SC (U18530); SEC7A_RN (U83895); SEC7B_RN (U83896); SEC7C_RN (U83897); TYL_HS (X99688). AT, Arabidopsis thaliana; HS, Homo sapiens; MM, Mus musculus; RN, Rattus norvegicus; SC, Saccharomyces cerevisae. Trends in Biochemical Sciences 1999 24, DOI: (10.1016/S0968-0004(99)01402-4)