Features of the Protein Encoded by the Ruby Transcript

Slides:

Advertisements

Similar presentations

MYB Family Transcription Factors Jonathan Russell Rena Schweizer Mike Douglas.

Advertisements

Protein Structure Investigating DFR specificity in anthocyanin biosynthesis Fazeeda Hosein Sarasvati BahadurSingh Nigel Jalsa Cecilia Diaz David Gopaulchan.

Genomic Organization and Evolutionary Conservation of Plant D-Type Cyclins by Margit Menges, Giulio Pavesi, Piero Morandini, Laszlo Bögre, and James A.H.

Figure S1_Yao Qin et al. Figure S1 Occurrence and distribution of trihelix family in different plant species. Red branches in the cladogram indicate that.

What Makes the “Blue” in Blueberries? -The Truth about Myb Dylan Coughtrey Laboratory Methods in Genomics Spring 2011.

Supplemental Figure 1S. Alignment and phylogeny of CRY proteins. Comparison of the amino acid sequences of the DNA-photolyase domain (a) and FAD binding.

The WRKY superfamily of plant transcription factors.

Figure S1. Effects of AVG, DIECA, DPI, NMMA, STA, and OKA on IbRPK expression in sweet potato (Ipomoea batatas cv. Tainung 57). Leaves with petiole cuts.

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

Cluster I. Cluster II Cluster III (contiued) Cluster IV.

Prospecting for Genes that Fueled the Green Revolution

Fig. S1. Amino acid sequence alignment of MYBS3 proteins. MYBS3 protein sequences of Arabidopsis thaliana (MYBH; NP_199550); (At3g16350; NP_188256), Glycine.

I Ia II Ib I IaIb IIIII IV V VI Figure S1. Comparison of amino acid sequence of O. sativa (Os) SUV3 (1-579) with SUV3 from A. thaliana (At) (1-571), H.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Fig. S1. Carotenoid and chlorophyll composition of Arabidopsis Z-ISO mutants compared to wild type. Seedlings were grown for 6d on half strength MS plus.

Supplementary Fig. 1. (A) PCR amplification of wheat TaHSP26 genomic, cDNA and ORF clones. (B) ORF and protein sequence of TaHSP26. An arrowhead indicates.

Supplemental Figure 1 GhCWIN1 (1) Atßfruct2 (1) Lin6 (1) NtCWIN1 (1) OsCWIN1 (1) ZmCWIN1 (1) Atßfruct4 (1) GhVIN1 (1) GhCWIN1 (45) Atßfruct2 (45) Lin6.

Supplemental Fig. S1. Orange- and yellow-flowered cultivars of calendula used in this study. Alice OrangeOrange StarPompom OrangeOrange Gem Alice YellowGold.

Myb Transcription Factors Dylan Coughtrey Laboratory Methods in Genomics Spring 2011.

gDNA Atg1-F Atg2-F MW Supplemental Figure S1   Supplemental Figure S1. Agarose gel electrophoresis of the PCR products generated.

Supplemental Fig. S1 A B AtMYBS aa AtMYBS

From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins

S1 Table. The protein sequences Glycine max St8 MER3 and 18 homologous proteins used for phylogenetic analysis. S. No. Gene Name/ ID Protein type 1 Glyma.06G

(A) rRNA (B) OsAGPL3 rRNA (C) Time after transfer （h）

Phylogenetic analysis of CADs and oxidoreductases involved in specialized metabolism (ORSMs). Phylogenetic analysis of CADs and oxidoreductases involved.

Toward Systems Understanding of Leaf Senescence: An Integrated Multi-Omics Perspective on Leaf Senescence Research Jeongsik Kim, Hye Ryun Woo, Hong Gil.

Volume 6, Issue 3, Pages (May 2013)

Volume 8, Issue 6, Pages (June 2015)

Zhu Hui-Fen , Fitzsimmons Karen , Khandelwal Abha , Kranz Robert G.

Motif 1 Motif 3 Motif 6 Motif 2 Motif 5 Motif 4 Motif 4 Motif 1

Volume 3, Issue 3, Pages (May 2010)

The Ins and Outs of the Rice AGAMOUS Subfamily

The 130-bp key region of the promoter of TsVP1 is a direct binding target of TsNAC1. The 130-bp key region of the promoter of TsVP1 is a direct binding.

Volume 21, Issue 8, Pages (April 2011)

Phosphopeptides identified harboring minimal binding motifs

Volume 1, Issue 2, Pages (March 2008)

Gene structures, positions of mutations, and protein domains of PRP18 paralogs in Arabidopsis. Gene structures, positions of mutations, and protein domains.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Toward Systems Understanding of Leaf Senescence: An Integrated Multi-Omics Perspective on Leaf Senescence Research Jeongsik Kim, Hye Ryun Woo, Hong Gil.

The Presence and Localization of Thioredoxins in Diatoms, Unicellular Algae of Secondary Endosymbiotic Origin Weber Till , Gruber Ansgar , Kroth Peter.

Daniel P. Wickland, Yoshie Hanzawa Molecular Plant

The PHANTASTICA Gene Encodes a MYB Transcription Factor Involved in Growth and Dorsoventrality of Lateral Organs in Antirrhinum Richard Waites, Harinee.

Expression and Histone H4 Acetylation Levels of MAPK6 and WRKY53 in the HDT701 OX and RNAi Plants after M. oryzae Inoculation. Expression and Histone H4.

Expression of the AREB1 Gene and Subcellular Localization of the AREB1 Protein.(A) Structure of AREB1 family proteins. Expression of the AREB1 Gene and.

Correction of Gene Annotation and Other Sequence Analysis of Arabidopsis Proteins Identified on the 2-D Gels in Figure 1.(A) Spot 71, identified as a 17.2-kD.

Phylogenetic analysis and amino acid sequences comparison of HO endonucleases. Phylogenetic analysis and amino acid sequences comparison of HO endonucleases.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Volume 11, Issue 6, Pages (June 2018)

Multiplexed Mutagenesis Using the Csy4 System in Tomato Protoplasts.

Phosphopeptides identified harboring minimal binding motifs

Phylogenetic analysis and domain structure of CALM proteins.

Genetic and Physical Maps of W1/Iw1.

Volume 3, Issue 3, Pages (May 2010)

Depiction of wild-type and mutated Hes6 proteins.

Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon Insertion in the Candidate Gene. Genomic Sequence of Ufo1-1 Reveals a Novel CACTA Transposon.

The NB-ARC domain: a novel signalling motif shared by plant resistance gene products and regulators of cell death in animals Erik A. van der Biezen,

Neighbor-Joining Tree of B-Class MADS Box Genes from P

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

Domain analysis of GmPHD6 binding to LHP1, DNA element, and histone H3

Subcellular Localization of At4g19010

Mutation of CERKL, a Novel Human Ceramide Kinase Gene, Causes Autosomal Recessive Retinitis Pigmentosa (RP26) Miquel Tuson, Gemma Marfany, Roser Gonzàlez-Duarte

Maps of Structures of the Ruby Locus in the Different Citrus Species, Orange Accessions, and Hybrids.Thick green arrows, retrotransposon LTRs; thick gray.

Genomic Characterization of the Ruby Locus

Volume 3, Issue 2, Pages (March 2010)

Natesan Senthil Kumar A. , Sullivan James A. , Gray John C.

S. moellendorffii BBI3 Is Predicted to Be a BBI Based on Sequence Similarity at the Inhibitory Motifs and Shared Primary Protein Architecture. S. moellendorffii.

Volume 1, Issue 5, Pages (September 2008)

Expression of Tcs1, Ruby, and Anthocyanin Production in Blood and Blond Oranges in Response to Cold Storage.(A) Detailed map of the Ruby locus with the.

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Presentation transcript:

Features of the Protein Encoded by the Ruby Transcript Features of the Protein Encoded by the Ruby Transcript.(A) Protein alignment of Ruby with characterized members of the anthocyanin-specific family of Myb factors (http://multalin.toulouse.inra.fr/multalin/). Features of the Protein Encoded by the Ruby Transcript.(A) Protein alignment of Ruby with characterized members of the anthocyanin-specific family of Myb factors (http://multalin.toulouse.inra.fr/multalin/). Identical amino acids are shown in pink. The GenBank accession numbers of these proteins are as follows: Ph AN2 (Petunia × hybrida), AAF66727.1; Sl AN1 (tomato [Solanum lycopersicum]), AAQ55181.1; Vv MYBA1 (V. vinifera), ABB87013.1; Ib MYB1 (Ipomoea batatas), BAF45118.1; At PAP1 (Arabidopsis), ABB03877.1; and Am ROSEA1 (snapdragon), ABB83826.1. Arrowheads indicate the region to which degenerate primers were designed. The signature motif for interaction with bHLH proteins within the R3 Myb DNA binding domain and the conserved motif defining members of R2R3 Myb subgroup 6 are boxed in gray.(B) Phylogenetic analysis showing that the Ruby transcription factor clusters with anthocyanin-specific members of subgroup 6 from the R2R3MYB family. Bootstrap values are shown if significant at or above the 90% confidence limit. Locus identifiers for Arabidopsis proteins are At MYB3 (At1g22640), At MYB4 (At4g38620), At MYB6 (At4g09460), At MYB7 (At2g16720), At MYB8 (At1g35515), At MYB13 (At1g06180), At MYB14 (At2g31180), At MYB15 (At3g23250), At MYB32 (At4g34990), At MYB11 (At3g62610), At MYB12 (At2g47460), At MYB111 (At5g49330), At MYB113 (At1g66370), At MYB114 (At1g66380), At MYB75 (At1g56650), At MYB90 (At1g66390), and At MYB123 (At5g35550). Identifiers for snapdragon proteins are Am MYB308 (P81393), Am MYB330 (P81395), Am ROSEA1 (DQ275529), Am ROSEA2 (DQ275530), and Am VENOSA (DQ275531). Identifiers for maize (Zea mays) proteins are Zm MYB42 (AM156908), Zm MYBC1 (X06333), Zm MYBP (U57002), and Zm MYBPL (L19494). Identifiers for grape proteins are Vv MYBF1 (FJ948477), Vv MYBA1 (AB097923), and Vv MYBA2 (AB097924). Identifiers for tobacco proteins are Nt MYB2 (AB028649) and Nt MYBJS1 (AB236951). Identifiers for tomato proteins are Sl MYB12 (EU419748) and Sl ANT1 (AY348870). Identifiers for other proteins are as follows: Cs Ruby from sweet orange (this study, GenBank/EMBL JN402334); Dc MYB1 from carrot (Daucus carota) (AB218778); Os MYB4 from rice (Oryza sativa) (Y11414); Na MYB8 from Nicotiana attenuata (GU451752); Eg MYB1 from Eucalyptus gunnii (AJ576024); Pt MYB14 from Pinus taeda (DQ399056); Sb MYBY1 from sorghum (Sorghum bicolor) (AY860968); and Ph AN2 from petunia (Petunia hybrida) (AF146702). Eugenio Butelli et al. Plant Cell 2012;24:1242-1255 ©2012 by American Society of Plant Biologists