Possible secondary structure of the S. enterica prs leader.

Slides:

Advertisements

Similar presentations

The Build-up of the Red Sequence at z

Advertisements

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

Structure of in‐frame deletions.

Inferring chromatin organization.

Mechanism of PRPP-mediated regulation of transcription by PyrR and PurR. Mechanism of PRPP-mediated regulation of transcription by PyrR and PurR. PyrR.

Shielding of bacterial spores against galactic cosmic radiation by meteorite material. Shielding of bacterial spores against galactic cosmic radiation.

Three-dimensional structure of B. subtilis PRPP synthase.

Allosteric site of B. subtilis PRPP synthase.

Cross-section of a spore of B. subtilis.

Biochemical function of PRPP

Solar spectrum in space (thin line) and on Earth's surface (thick line). Solar spectrum in space (thin line) and on Earth's surface (thick line). Below.

Comparison of amino acid regions forming [4Fe-4S] clusters in the SplB amino acid sequences from Bacillus anthracis (B.an), B. amyloliquefaciens (B.am),

Phylogenetic analysis of PurR from low-GC Gram-positive bacteria.

N-Glycosidic bond formation with PRPP

Phrap assemblies visualized with the Consed (53) program.

Catalytic strategies. Catalytic strategies. The coordination of Mg2+ (shown as blue spheres) of the active site to the substrates, to amino acid residues,

Catalytic mechanism of PRPP synthase.

Alignments of the complete genome sequences of the B

CTL killing and hepatocyte replacement.

iraL shares sequence identity with iraM from E

Current model for Fe-S cluster assembly by the Suf system.

Alignment of N-terminal sequences of type IV pilin proteins.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

Summary of major events in Earth history relating to the appearance of eukaryotic groups and the appearance of O2 in the atmosphere and in marine environments.

Structure of PrfA (A) and its target DNA sequences in PrfA-regulated promoters (B). Structure of PrfA (A) and its target DNA sequences in PrfA-regulated.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Structures of P. aeruginosa ExoU and its chaperone, SpcU (PDB ID 3TU3), shown as a cartoon. Structures of P. aeruginosa ExoU and its chaperone, SpcU (PDB.

Summary of the distribution and genetic context of the OXA-type enzymes in Acinetobacter baumannii. Summary of the distribution and genetic context of.

Electron micrograph of negatively stained protofilaments assembled in vitro from E. coli FtsZ (1 μM FtsZ, 50 mM MES [morpholineethanesulfonic acid] [pH.

Schematic representation of the hydrolysis of amorphous and microcrystalline cellulose by noncomplexed (A) and complexed (B) cellulase systems. Schematic.

Antibiofilm strategies arising from fundamental research.

UV resistance of spores and vegetative cells of B

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Scheme for recovery of viral nucleic acid from microarray spots.

T4P gene clusters in C. perfringens and C. difficile.

Protein structures of various PFT classes.

Extreme resistance of D

SMase cleavage sites in sphingomyelin and cellular activities of the reaction products. SMase cleavage sites in sphingomyelin and cellular activities of.

Physiological effects of heat shock.

Diagram of the relationship between the T4 transcriptional pattern and the different mechanisms of DNA replication and recombination. Diagram of the relationship.

Prophage genome map of the C. diphtheriae prophage encoding DT

Molecular models for module exchange between phages.

MEED exposure facility mounted on the camera beam of the lunar orbiter of the Apollo 16 mission (A) and sample cuvette for exposing dry layers of microorganisms.

Binding of mRNA to the 30S ribosomal subunit.

Mechanisms of XRV and ERV transmission.

Phylogenetic trees for fusion (F) and attachment (G) genes of selected HMPV isolates. Phylogenetic trees for fusion (F) and attachment (G) genes of selected.

Structural features of seven streptococcal cell surface proteins that function in adherence and colonization. Structural features of seven streptococcal.

General scheme of the events triggered by C

Conserved motifs in the ABC

Absorption spectra of PRs in relation to light attenuation patterns in different marine environments. Absorption spectra of PRs in relation to light attenuation.

The selective advantage (relative fitness) of a mutant genome (with its associated cloud) alters the rate of dominance in a population. The selective advantage.

Thermodynamic cycle for ligand binding to a periplasmic-BP.

Intrastrand biases (nucleotide skew) in the T4 genome.

A, Schematic diagram of identified splice variants of PD-L1.

General overview of the bioinformatic pipelines for the 16S rRNA gene microbial profiling and shotgun metagenomics. General overview of the bioinformatic.

Mono-ADP-ribosylation cycle and the corresponding products of protein mono-ADP-ribosylation. Mono-ADP-ribosylation cycle and the corresponding products.

Comparison of the van gene clusters.

IS200 complex. IS200 complex. (A) Organization of IS200. Short IRs (open arrows) are shown at the left end, and the relative position of the potential.

Repair kinetics of radiation-induced DNA damage under microgravity conditions. Repair kinetics of radiation-induced DNA damage under microgravity conditions.

IF2 and structural homologues.

Amino acid sequence similarity among C

Sequence alignment of colicin lysis proteins.

TolA, TolB, and Pal crystal structures.

16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts. 16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts.

Molecular model of the Helicobacter pylori PldA1 dimer.

Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein of E. coli. Lipid and peptidoglycan attachment of the murein (Braun’s) lipoprotein.

Structure of an ATP-bound ABC dimer.

Presentation transcript:

Possible secondary structure of the S. enterica prs leader. Possible secondary structure of the S. enterica prs leader. The sequence ranges from nucleotide 1, indicated by 5′, to nucleotide 417, which is immediately followed by the initiator codon-specifying guanylate-uridylate-guanylate triplet and is indicated by 3′ (45). The ΔG of the structure is −540 kJ mol−1. The leader prs sequences of S. enterica and E. coli are identical except for the framed sequence, which is present only in the S. enterica prs leader. The nucleotides circled in red represent a possible leader peptide, and the red arrows point to the nucleotides of a possible Shine-Dalgarno sequence. Possible leader peptide amino sequences are indicated for E. coli and S. enterica. Identical amino acid residues of the two possible leader peptides are underlined. Bjarne Hove-Jensen et al. Microbiol. Mol. Biol. Rev. 2017; doi:10.1128/MMBR.00040-16