Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L

Slides:

Advertisements

Similar presentations

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Advertisements

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

From: Three Novel Pax6 Alleles in the Mouse Leading to the Same Small-Eye Phenotype Caused by Different Consequences at Target Promoters Invest. Ophthalmol.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.

Protein-Truncation Mutations in the RP2 Gene in a North American Cohort of Families with X-Linked Retinitis Pigmentosa Alan J. Mears, Linn Gieser, Denise.

Performance Evaluation of the TheraTyper-GJB2 Assay for Detection of GJB2 Gene Mutations Ji-Yong Chun, Soo-Kyung Shin, Kyung Tae Min, Woojae Cho, Jaeil.

Volume 6, Issue 4, Pages (October 2000)

Mark M Metzstein, H.Robert Horvitz Molecular Cell

Deficiency of the ADP-Forming Succinyl-CoA Synthase Activity Is Associated with Encephalomyopathy and Mitochondrial DNA Depletion Orly Elpeleg, Chaya.

P. M. Kelley, D. J. Harris, B. C. Comer, J. W. Askew, T. Fowler, S. D

Familial Deafness, Congenital Heart Defects, and Posterior Embryotoxon Caused by Cysteine Substitution in the First Epidermal-Growth-Factor–Like Domain.

A Hypervariable Invertebrate Allodeterminant

Jacquelyn Bond, Sheila Scott, Daniel J

Cohen Syndrome Is Caused by Mutations in a Novel Gene, COH1, Encoding a Transmembrane Protein with a Presumed Role in Vesicle-Mediated Sorting and Intracellular.

Syndromic Short Stature in Patients with a Germline Mutation in the LIM Homeobox LHX4 Kalotina Machinis, Jacques Pantel, Irène Netchine, Juliane Léger,

Performance Evaluation of the TheraTyper-GJB2 Assay for Detection of GJB2 Gene Mutations Ji-Yong Chun, Soo-Kyung Shin, Kyung Tae Min, Woojae Cho, Jaeil.

Michael Field, Patrick S

Mutations in ZDHHC9, Which Encodes a Palmitoyltransferase of NRAS and HRAS, Cause X-Linked Mental Retardation Associated with a Marfanoid Habitus F.

Volume 84, Issue 3, Pages (February 1996)

Volume 20, Issue 12, Pages (June 2010)

Progress in Molecular Genetics of Heritable Skin Diseases: The Paradigms of Epidermolysis Bullosa and Pseudoxanthoma Elasticum Jouni Uitto, Leena Pulkkinen,

Mutations in a Novel Gene with Transmembrane Domains Underlie Usher Syndrome Type 3 Tarja Joensuu, Riikka Hämäläinen, Bo Yuan, Cheryl Johnson, Saara.

Molecular Characterization of WFS1 in Patients with Wolfram Syndrome

Myotonic Dystrophy Type 2: Human Founder Haplotype and Evolutionary Conservation of the Repeat Tract Christina L. Liquori, Yoshio Ikeda, Marcy Weatherspoon,

Volume 117, Issue 3, Pages (September 1999)

Volume 64, Issue 4, Pages (October 2003)

Mutations in TRIOBP, Which Encodes a Putative Cytoskeletal-Organizing Protein, Are Associated with Nonsyndromic Recessive Deafness Saima Riazuddin, Shaheen.

Antigenic Variation in Malaria

Characterization of two novel gene cassettes, dfrA27 and aadA16, in a non-O1, non- O139 Vibrio cholerae isolate from China J. Sun, M. Zhou, Q. Wu, Y.

Genotype/Phenotype Analysis of a Photoreceptor-Specific ATP-Binding Cassette Transporter Gene, ABCR, in Stargardt Disease Richard Alan Lewis, Noah F.

Clustering of Activating Mutations in c-KIT’s Juxtamembrane Coding Region in Canine Mast Cell Neoplasms Yongsheng Ma, B. Jack Longley, Xiaomei Wang

Genetic Mapping Refines DFNB3 to 17p11

Thomas C. Hart, Yingze Zhang, Michael C. Gorry, P

lin-35 and lin-53, Two Genes that Antagonize a C

A Multi-Exonic BRCA1 Deletion Identified in Multiple Families through Single Nucleotide Polymorphism Haplotype Pair Analysis and Gene Amplification with.

Mental Retardation and Abnormal Skeletal Development (Dyggve-Melchior-Clausen Dysplasia) Due to Mutations in a Novel, Evolutionarily Conserved Gene Daniel.

A Nonsense Mutation in CRYBB1 Associated with Autosomal Dominant Cataract Linked to Human Chromosome 22q Donna S. Mackay, Olivera B. Boskovska, Harry.

A Presenilin-1 Truncating Mutation Is Present in Two Cases with Autopsy-Confirmed Early-Onset Alzheimer Disease Carolyn Tysoe, Joanne Whittaker, John.

Mutations of MYO6 Are Associated with Recessive Deafness, DFNB37

Mutation of Solute Carrier SLC16A12 Associates with a Syndrome Combining Juvenile Cataract with Microcornea and Renal Glucosuria Barbara Kloeckener-Gruissem,

Qiong A. Liu, Michael O. Hengartner Current Biology

Targeted Capture and Next-Generation Sequencing Identifies C9orf75, Encoding Taperin, as the Mutated Gene in Nonsyndromic Deafness DFNB79 Atteeq Ur Rehman,

Mutations of the Ephrin-B1 Gene Cause Craniofrontonasal Syndrome

Mutations in ZDHHC9, Which Encodes a Palmitoyltransferase of NRAS and HRAS, Cause X-Linked Mental Retardation Associated with a Marfanoid Habitus F.

A Mutation in the Variable Repeat Region of the Aggrecan Gene (AGC1) Causes a Form of Spondyloepiphyseal Dysplasia Associated with Severe, Premature.

Deletion of PREPL, a Gene Encoding a Putative Serine Oligopeptidase, in Patients with Hypotonia-Cystinuria Syndrome Jaak Jaeken, Kevin Martens, Inge.

Opitz G/BBB Syndrome in Xp22: Mutations in the MID1 Gene Cluster in the Carboxy- Terminal Domain Karin Gaudenz, Erich Roessler, Nandita Quaderi, Brunella.

Fredrik Elinder, Michael Madeja, Hugo Zeberg, Peter Århem

Identification of FOXP2 Truncation as a Novel Cause of Developmental Speech and Language Deficits Kay D. MacDermot, Elena Bonora, Nuala Sykes, Anne-Marie.

Matthew R. Avenarius, Michael S. Hildebrand, Yuzhou Zhang, Nicole C

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

Stella Plakidou-Dymock, David Dymock, Richard Hooley Current Biology

Maple Syrup Urine Disease: Identification and Carrier-Frequency Determination of a Novel Founder Mutation in the Ashkenazi Jewish Population Lisa Edelmann,

A Unique Point Mutation in the PMP22 Gene Is Associated with Charcot-Marie-Tooth Disease and Deafness Margaret J. Kovach, Jing-Ping Lin, Simeon Boyadjiev,

The Gene Mutated in Variant Late-Infantile Neuronal Ceroid Lipofuscinosis (CLN6) and in nclf Mutant Mice Encodes a Novel Predicted Transmembrane Protein

Molecular Genetics of the Caveolin Gene Family: Implications for Human Cancers, Diabetes, Alzheimer Disease, and Muscular Dystrophy Jeffrey A. Engelman,

Volume 10, Issue 4, Pages (February 2000)

KIT Gene Deletions at the Intron 10−Exon 11 Boundary in GI Stromal Tumors Christopher L. Corless, Laura McGreevey, Ajia Town, Arin Schroeder, Troy Bainbridge,

Transcriptional Control of SLC26A4 Is Involved in Pendred Syndrome and Nonsyndromic Enlargement of Vestibular Aqueduct (DFNB4) Tao Yang, Hilmar Vidarsson,

Mental Retardation and Abnormal Skeletal Development (Dyggve-Melchior-Clausen Dysplasia) Due to Mutations in a Novel, Evolutionarily Conserved Gene Daniel.

Atteeq U. Rehman, Regie Lyn P. Santos-Cortez, Robert J

Mutations in the Gene Encoding Capillary Morphogenesis Protein 2 Cause Juvenile Hyaline Fibromatosis and Infantile Systemic Hyalinosis Sandra Hanks,

Arun Kumar, Satish C. Girimaji, Mahesh R. Duvvari, Susan H. Blanton

A Missense Mutation in a Highly Conserved Region of CASQ2 Is Associated with Autosomal Recessive Catecholamine-Induced Polymorphic Ventricular Tachycardia.

Cohen Syndrome Is Caused by Mutations in a Novel Gene, COH1, Encoding a Transmembrane Protein with a Presumed Role in Vesicle-Mediated Sorting and Intracellular.

Exon Skipping in IVD RNA Processing in Isovaleric Acidemia Caused by Point Mutations in the Coding Region of the IVD Gene Jerry Vockley, Peter K. Rogan,

Identification of a New Splice Form of the EDA1 Gene Permits Detection of Nearly All X- Linked Hypohidrotic Ectodermal Dysplasia Mutations Alex W. Monreal,

Mutations in Two Nonhomologous Genes in a Head-to-Head Configuration Cause Ellis- van Creveld Syndrome Victor L. Ruiz-Perez, W.J. Stuart Tompson, J. Helen.

Identification of novel polymorphisms in the nuclear protein genes and their relationship with human sperm protamine deficiency and severe male infertility

Volume 12, Issue 5, Pages (May 2005)

Presentation transcript:

Mutations in a Novel Gene, TMIE, Are Associated with Hearing Loss Linked to the DFNB6 Locus Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L. Mitchem, Saima Riazuddin, Robert J. Morell, Arabandi Ramesh, Srikumari Srisailpathy, Dilip Deshmukh, Sheikh Riazuddin, Andrew J. Griffith, Thomas B. Friedman, Richard J.H. Smith, Edward R. Wilcox The American Journal of Human Genetics Volume 71, Issue 3, Pages 632-636 (September 2002) DOI: 10.1086/342193 Copyright © 2002 The American Society of Human Genetics Terms and Conditions

Figure 1 Families showing linkage to DFNB6 and TMIE mutation analyses. A, Family I-51, from India, defined the minimum interval for DFNB6 as being between markers D3S3582 and D3S1613. Sequence chromatograms from a noncarrier (II:4) and a deaf individual (IV:2) show the wild-type sequence, the place of insertion (arrowhead), and the insertion of CGCC (bracketed) in exon 2, respectively. B, 250C→T transition in exon 3 in an affected individual (II:1) from family 5020-22, compared with the wild-type sequence. C, The chromatograms show sequence of the intron 1–exon 2 boundary in PKSN21, from a noncarrier and an affected individual with the deletion of seven bases (bracketed in wild type). The site of the deletion is indicated by an arrowhead, along with an insertion of cytosine (arrow). D, The sequence traces of a wild type and an affected individual (IV:2) in family PKSR22B with the 241C→T transition (arrows). E, Chromatograms from an unaffected control individual and an affected individual (IV:1) from family PKDF76, showing the 274C→T transition (arrows). The American Journal of Human Genetics 2002 71, 632-636DOI: (10.1086/342193) Copyright © 2002 The American Society of Human Genetics Terms and Conditions

Figure 2 Diagrammatic representations of TMIE and TMIE. A, The boxed regions depict exons of TMIE. Slashed lines represent introns. The length of each exon and intron is given in base pairs (bp), within boxes (for exons) and below slashed lines (for introns). “ATG” denotes the initiation codon, and the asterisk (*) marks the stop codon. Mutations found in the five families showing linkage to DFNB6 are shown above the respective exons. We obtained a 1023-bp 3′ UTR followed by a poly A tail. BLAST analysis of the TMIE cDNA sequence identified ESTs corresponding to a 1202-bp 3′ UTR because of utilization of a different polyadenylation signal. B, Clustal W alignment of deduced amino acid sequences of Tmie and TMIE. The shared amino acid identity between Tmie (mouse) and TMIE (human) is indicated by shaded boxes: dark gray for absolute identity and light gray for conservative changes. Dashes (—) show gaps in the alignment. TMIE has two potential sites of signal peptide cleavage (arrows), and two predicted transmembrane regions (black bars on top of amino acid residues). Cleavage of the signal peptide would result in a protein with an extracellular amino terminus, one transmembrane segment, and an intracellular carboxy terminus. The C-terminus has many positively charged amino acids interspersed with negatively charged residues (charge indicated on top of each residue) and three potential protein kinase phosphorylation sites (bold underlines). Arrowheads indicate arginine residues in TMIE mutated in affected individuals in three families linked to DFNB6. The American Journal of Human Genetics 2002 71, 632-636DOI: (10.1086/342193) Copyright © 2002 The American Society of Human Genetics Terms and Conditions