Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic.

Slides:

Advertisements

Similar presentations

MVKFLFSVIILFFLLSAVGSSARNIEEDGVIRLPSEVKDFINGKNIDDDSVGGTRWAVLI 60 AGSSGYWNYRHQADVCHAYQVLKRGGVKDENIVVFMYDDIALNEENPRPGVIINHPKGED 120 VYAGVPKDYTGRDVTAHNFYSVLLGNKTAVKGGSGKVIDSGPNDHIFIYYSDHGGPGVLG.

Advertisements

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

Figure S1: Seventeen MHC alleles in lake whitefish including nucleotide and amino acid sequences. Putative peptide binding region (PBR) sites are indicated.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

Avery A. Sandberg, Julia A. Bridge Cancer Genetics and Cytogenetics

Sequence and comparison of the SDS protein.

Schematic view of SGI1-L and its specific features encountered in Morganella morganii strain LIM90. Schematic view of SGI1-L and its specific features.

Pedigrees of the families of patients 1 and 2 show that the clinical phenotype co-segregates with compound heterozygous CLDN10 variants. Pedigrees of the.

Supplemental Figure S1. Alignment of drimenol synthase amino acid sequences from P. hydropiper and V. officinalis. Amino acid sequences were aligned with.

(A) Block diagram of the precursor proteins predicted from the Oak1, 2, 3, and 4 clones showing the signal peptide (light shading), the regions corresponding.

Relationship between Genotype and Phenotype

ClustalOmega alignment of FlaC protein sequences.

Homology network of 4,131 putative oomycete RxLR effectors.

Properties of H. volcanii tRNA Intron Endonuclease Reveal a Relationship between the Archaeal and Eucaryal tRNA Intron Processing Systems Karen Kleman-Leyer,

Genomic context, sequence identity, and structural homology modeling of the aadA31 gene detected in P. multocida PM13 and H. somni HS31. Genomic context,

STAT Genes Found in C. elegans

Genomes with Fe-S cluster assembly-related genes.

Positions of LSUCC isolates relative to matching OTUs within the top 60 ranks for the most successful experiment, CJ2, which is enlarged to allow for OTU.

Comparison of the variable regions of (A) pHNZY32, pHNZY118, and pHNAH24; (B) pHNMCC14; (C) pHNFKU92; (D) pE80; (E) pECB11; (F) p42-2; and (G) pSLK172-2.

SEM images of S. aureus ATCC cells left untreated (A) or treated with polymyxin B (PMB; 99.5 mg/liter) (B), FADDI-019 (1× MIC) (C), FADDI-019 (4×

Correction of translational start site by identification of N-terminal peptide. Correction of translational start site by identification of N-terminal.

Polymorphism discovery in 09-CB1 × IPO323 versus 09-ASA-3apz × IPO94269 bulks. Polymorphism discovery in 09-CB1 × IPO323 versus 09-ASA-3apz × IPO94269.

RAD51 is essential for L. donovani.

(A) Tiled view of an ESOM map constructed using all 51 metagenome bins assembled from the samples collected in this study, with the white square encompassing.

Comparative analysis of Aeromonas sp.

Quiescence of the E. coli CFT073 original clinical isolate on glucose plates. Quiescence of the E. coli CFT073 original clinical isolate on glucose plates.

Histidine kinases are expanded in the fusaria.

WES identification of heterozygous compound mutations in ALPI

KEGG pathway analysis of the C

Bioinformatics analysis of the small TbTim amino acid sequences.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

SDS-PAGE of IGFBP-5 from 32P-labeled T47D cells and separation of tryptic phosphopeptides separated by HPLC.a, an autoradiograph (lane 1) is shown next.

WES identification of heterozygous compound mutations in ALPI

iraL shares sequence identity with iraM from E

Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins and the domains of HB-EGF. Alignment of putative chicken HB-EGF to mammalian HB-EGF proteins.

Introduction of an autocatalytic hammerhead ribozyme sequence permits use of the optimal T7 promoter to enhance transcription levels. Introduction of an.

Generation of heterozygous mutations with the CRISPR-Cas9 system.

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Dynamic ranges of anti-PnPS IgG Reference standard serum 007sp for each of 13 serotypes. Dynamic ranges of anti-PnPS IgG Reference standard serum 007sp.

Mosquito GluCl alignment and anti-AgGluCl IgG specificity.

General structure of RIFINs and STEVORs

TEM observation of the bacterial damage caused by egg white.

Alignment of the deduced amino acid sequences of the myosin light chain 2 (MLC2) proteins. Alignment of the deduced amino acid sequences of the myosin.

dnpc1a gene and mutant phenotypes.

Multiple sequence alignment of Twisted gastrulation (TSG) proteins.

Domain organization of GAMA proteins and proteolytic processing of TgGAMA. Domain organization of GAMA proteins and proteolytic processing of TgGAMA. (A)

The Amazon viral scaffolds and viral genomes most important for river and plume segregation. The Amazon viral scaffolds and viral genomes most important.

Phylogenetic tree of K. variicola from humans and animals.

Comparison of the sequences of Fzo/Mfn and structure of mammalian Mfn2

Phylogenetic analysis of K. quasipneumoniae subsp

Uptake of amino acids by C. albicans.

Comparison of the predicted amino acid sequences of murine Rin (GenBank accession number U71202), human Rin (U71204), murine Rit (U71205), human Rit (U71203),

The zebrafish ortholog of human JunB is expressed in the zebrafish heart. The zebrafish ortholog of human JunB is expressed in the zebrafish heart. (A)

Structural features of Rps26a.

Sequence comparisons of fungal HOG1 orthologues.

OMV-enriched proteins show a conserved N-terminal LES motif.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Molecular structure of MFS1 promoter genotypes.

S protein sequence-based phylogenetic analyses of alphacoronaviruses.

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

Phylogenetic relationships between PBVs isolated in this study and representative members of the family Picobirnaviridae, based on the amino acid sequence.

Detection (colored) or nondetection (white) of ARGs corresponding to specific ARG mechanisms. Detection (colored) or nondetection (white) of ARGs corresponding.

Comparison of the van gene clusters.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Sequence alignment of colicin lysis proteins.

Amino acid sequence of antigenic fragments 52/3 and UL57/3 of pUL44 and pUL57, respectively, and sequence comparison by dot plot analysis. Amino acid sequence.

Residues 327 and 404 are key binding sites for GII. 4F MAb

Alignment of the Amino Acid Sequences of NCS and Other PR10/Bet v1 Proteins from Various Plant Species.Deduced amino acid sequences were aligned using.

Confirmation of spliced RNA in cells transfected with a wild-type or Pol(−) MR766 ZIKV plasmid. Confirmation of spliced RNA in cells transfected with a.

Presentation transcript:

Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Protein sequence alignments for the BcfD (A) and StfH (B) allelic groups from S. Newport. Alignments were made using ClustalW (MegAlign; DNAStar, Madison, WI). Identical amino acids are shadowed in black with white text, while different amino acids appear as black text with no shadowing. Allelic sequence labels are indicated at left and amino acid positions at right. Arrows indicate predicted signal sequence cleavage sites. Leon De Masi et al. mSphere 2017; doi:10.1128/mSphere.00066-17