Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment.

Slides:

Advertisements

Similar presentations

Yersinia Palindromic Sequences Introduction to Bioinformatics 301 April 30th, 2015 Jordan Davis.

Advertisements

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

From: Pseudomonas Keratitis: Protease IV Gene Conservation, Distribution, and Production Relative to Virulence and Other Pseudomonas Proteases Invest.

Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons in mom1 and ddm1. Accumulation of transcripts from MULE‐F19G14–CyP40 and transposons.

The determinants of the interswitch toggle.

Prostaglandin E2 (PGE2) induces no significant alteration in circadian locomotor activity. Prostaglandin E2 (PGE2) induces no significant alteration in.

Statistical analysis of transgene expression in pigs generated by lentiviral gene transfer. Statistical analysis of transgene expression in pigs generated.

Sequence and expression of Xenopus EAF2.

The effect of amino acid substitution in the kinase inhibitory region of JAB. (A) Unchanged amino acids are shown as dots, substituted amino acids by a.

Model for the involvement of Rep helicases as genome packaging motors.

Different ubiquitin linkage types and their role in immune signallingUbiquitin, a small protein of 76 amino acids, can be attached to a substrate protein.

Surface distribution of immunogold‐labelled PS I (A–C) and ATP synthase (D–F) complexes. Surface distribution of immunogold‐labelled PS I (A–C) and ATP.

Nur77 interacts with COUP‐TF in yeast.

(A, B) Stereoscopic views of the P3 RNase MRP RNA domain in complex with the RNase MRP/RNase P protein components Pop6 and Pop7. (A, B) Stereoscopic views.

Protein sequences and three‐dimensional structures of HUB1 (homologous to ubiquitin 1), ubiquitin and ubiquitin‐like modifiers. Protein sequences and three‐dimensional.

Yeast containing pICC10 (Tir) and pICC267 (CK18) and pTY474S and pICC267 demonstrated an approximately 12.5‐fold increase in β‐galactosidase activity compared.

Growth advantage of strains carrying the different xer core sequences in place of dif over a Δ(dif) strain. Growth advantage of strains carrying the different.

1,25‐dihydroxyvitamin D3 and retinoic acid induce p19ink4d expression.

Xer recombination at variant sites.

FtsK‐independent dif recombination in the presence of HinXerC.

Morphological analyses of peripheral blood and bone marrow cells isolated from leukemic mice. Morphological analyses of peripheral blood and bone marrow.

Loss of OCTR‐1 signalling enhances the activation of XBP‐1‐mediated UPR pathway. Loss of OCTR‐1 signalling enhances the activation of XBP‐1‐mediated UPR.

Amino‐acid sequence of the heterogeneous nuclear RNP G protein family and RNA‐binding SELEX consensus sequence obtained for human RBMY. (A) Sequence alignment.

Data analysis of thermal proteome profiling

Sequence of the tRNAPhe gene P2 and Px transcripts.

Sequence and comparison of the SDS protein.

Multiple sequence alignment of the BAR domains from Amphiphysins and from the subset of BAR domain family members that were shown to bind to a small GTPase.

Recognition of double‐stranded telomeric DNA

Structure of in‐frame deletions.

Characterisation of proviral integrations in corrected stem cells Visualisation of COL7A1 sequence by FISH analysis in corrected stem cells at passage.

Clinical testing of calcineurin inhibitors cyclosporine A and tacrolimus in autoimmune disorders Clinical testing of calcineurin inhibitors cyclosporine.

Distribution of psychrophile genomes and metagenomes in different cold ecosystems(A) Pie chart of the relative proportions of sequenced psychrophile genomes.

The chloroplast 4.5S ribosomal RNA

Copper‐binding conformations and PrP octarepeat sequence mutations The structure of full‐length PrP and derivative C1 and C2 fragments with an enlarged.

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

INDRA Statements constructed from TRIPS NLP extractions, BioPAX, and BEL INDRA Statements constructed from TRIPS NLP extractions, BioPAX, and BEL An identical.

Pan2 exploits the asymmetry and forms an extensive interface with the Pan3 dimerStructural details of the complex of ctPan3 PKC bound to the Pan3 interacting.

Figure 3 Stepwise strategy of bioinformatic analysis of sequencing results We obtained 7,292,715 and 303,698 DNA sequence reads from the affected brain.

Mechanism of Triton binding to ShHTL7

Mapping of small RNAs to LINE‐1 sequence (related to Figs 3 and 4)‏

Tyr105 to Cys105 point mutation in human ZC3H10 is associated with altered metabolic phenotype Tyr105 to Cys105 point mutation in human ZC3H10 is associated.

Example of processed data visualized with “Peak Browser” of ChIP‐Atlas

Examples for intrachromosomal mRNA co‐regulation patches

Architecture of the chloroplast 70S ribosome

CRISPR knockdown can be multiplexed to modulate expression of two genes without cross‐talk CRISPR knockdown can be multiplexed to modulate expression of.

Sequence alignment of PHCCEx domains with secondary structure elements of the Tiam2 PHCCEx domain at the top. Sequence alignment of PHCCEx domains with.

Phylogenetic tree of 38 Pseudomonas type strains, based on the V3-V5 region sequence of the 16S rRNA gene (V3 primer, positions 442 to 492; and V5 primer,

Resolution and quality of the cryo‐EM reconstructions

DominoEffect R package

Examples of “Enrichment Analysis”

CD44 binding surface of the Tiam2 PHCCEx domain.

Example transcript and protein patterns.

WES identification of heterozygous compound mutations in ALPI

C266S laforin's effect on LD‐associated general defect in autophagy

Features of the LIMT gene and RNA abundance in cell lines of different tissues of origin Features of the LIMT gene and RNA abundance in cell lines of different.

Rare and abundant codons.

BT_0370 galactokinase and BT_371 glucose/galactose transporter

Purification and identification of RECQ4 complex from human cells.

WES identification of heterozygous compound mutations in ALPI

Direct interaction of RECQ4 and MCM10.

Overview of the ChIP‐Atlas data set and computational processing

Effect of rare SVs on cardiac transcription in DCM

Additional information on conditional knockouts

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Web pages for integrative analyses in ChIP‐Atlas

Ankyrin domain residues permit activation of LRRK2 by Rab29

Genomic organization of the fruBKA locus in Escherichia coli K-12 and Pseudomonas putida KT2440 and structure of the Cra binding site. Genomic organization.

Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins. Amino acid sequence alignment of Calliphora (Cv) and Drosophila (Dm) rhodopsins.

Alignment of Wt1 genomic regions reveals a highly conserved element upstream of zebrafish wt1a. Alignment of Wt1 genomic regions reveals a highly conserved.

ADAGE extracted features that represented sequence differences between strains. ADAGE extracted features that represented sequence differences between.

Presentation transcript:

Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 Secondary‐structure‐weighted sequence alignment of TssF1 with the N‐terminal region of gp6 and TssG1 with gp53 A, BProtein sequences were extracted from UniProt accession numbers BP06_BPT4 and BP53_BPT4 for enterobacteria phage T4 (gp6 and gp53, respectively; bacteriophage T4) and the Pseudomonas Genome Database (TssF1 and TssG1; reference strain PAO1). Conserved positions from (A) the TssF1/gp6 and (B) the TssG1/gp53 sequence alignments are shown in black and grey background. Secondary‐structure‐weighted sequence alignments were carried out using PROMALS3D. Sara Planamente et al. EMBO J. 2016;embj.201694024 © as stated in the article, figure or figure legend